Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human CCL18 protein

This Human CCL18 protein spans the amino acid sequence from region 21-89aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Alternative macrophage activation-associated CC chemokine 1 , AMAC-1CC chemokine PAR, CDendritic cell chemokine 1 , DC-CK1Macrophage inflammatory protein 4 , MIP-4Pulmonary and activation-regulated chemokine, Small-inducible cytokine A18

UniProt

P55774

Expression Region

21-89aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

9.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

E.coli and Yeast N-terminal 6xHis-tagged Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

AQVGTNKELCCLVYTSWQIPQKFIVDYSETSPQCPKPGVILLTKRGRQICADPNKKWVQKYISDLKLNA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GUCY2F Polyclonal Antibody
orb616118-01 50 μL

GUCY2F Polyclonal Antibody

Sign In for Pricing
View Details
GUCY2F Polyclonal Antibody
orb616118-02 100 µL

GUCY2F Polyclonal Antibody

Sign In for Pricing
View Details
COLEC11 Antibody
E310621 200 µL

COLEC11 Antibody

Sign In for Pricing
View Details
RASGRP3 Human shRNA Lentiviral Particle (Locus ID 25780)
TL317045V 500 µL Each

RASGRP3 Human shRNA Lentiviral Particle (Locus ID 25780)

Sign In for Pricing
View Details
Eppendorf Research Plus Pipettor 10-100ul 8 Channel
E3122000035 1 Each

Eppendorf Research Plus Pipettor 10-100ul 8 Channel

Sign In for Pricing
View Details
Acetonitrile-d3
TRC-A163892-25G 25 g

Acetonitrile-d3

Sign In for Pricing
View Details