Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human BTC protein

This Human BTC protein spans the amino acid sequence from region 32-178aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

BTCProbetacellulin [Cleaved into, Betacellulin, BTC) ]

UniProt

P35070

Expression Region

32-178aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

18.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

E.coli and Yeast N-terminal 6xHis-tagged Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

DGNSTRSPETNGLLCGDPEENCAATTTQSKRKGHFSRCPKQYKHYCIKGRCRFVVAEQTPSCVCDEGYIGARCERVDLFYLRGDRGQILVICLIAVMVVFIILVIGVCTCCHPLRKRRKRKKKEEEMETLGKDITPINEDIEETNIA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human Immunity-related GTPase family M protein Protein, GST, E.coli-200ug
QP6236-ec-200ug 200ug

Recombinant Human Immunity-related GTPase family M protein Protein, GST, E.coli-200ug

Sign In for Pricing
View Details
Anti-CD224 HC Antibody
MBS9239724-01 0.05 mL

Anti-CD224 HC Antibody

Sign In for Pricing
View Details
Anti-CD224 HC Antibody
MBS9239724-02 0.1 mL

Anti-CD224 HC Antibody

Sign In for Pricing
View Details
Anti-CD224 HC Antibody
MBS9239724-03 5x 0.1 mL

Anti-CD224 HC Antibody

Sign In for Pricing
View Details
Anti Teriparatide Pab
165770 100 µg

Anti Teriparatide Pab

Sign In for Pricing
View Details
PRKCZ peptide
orb217804-01 1 mg

PRKCZ peptide

Sign In for Pricing
View Details