Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human BTC protein

This Human BTC protein spans the amino acid sequence from region 32-178aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

BTCProbetacellulin [Cleaved into, Betacellulin, BTC) ]

UniProt

P35070

Expression Region

32-178aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

18.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

E.coli and Yeast N-terminal 6xHis-tagged Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

DGNSTRSPETNGLLCGDPEENCAATTTQSKRKGHFSRCPKQYKHYCIKGRCRFVVAEQTPSCVCDEGYIGARCERVDLFYLRGDRGQILVICLIAVMVVFIILVIGVCTCCHPLRKRRKRKKKEEEMETLGKDITPINEDIEETNIA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human BRUNOL4, GST-tagged
BRUNOL4-10299H 25 µg

Recombinant Human BRUNOL4, GST-tagged

Sign In for Pricing
View Details
Cyp26a1 3'UTR Luciferase Stable Cell Line
TU203044 1.0 mL

Cyp26a1 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
ACSS1 Antibody
OAAJ04610-100UL 100 µL

ACSS1 Antibody

Sign In for Pricing
View Details
POP4 Blocking Peptide
33R-2327 0.1 mg

POP4 Blocking Peptide

Sign In for Pricing
View Details
Olr1479 Protein Vector (Rat) (pPM-C-HA)
33971026 500 ng

Olr1479 Protein Vector (Rat) (pPM-C-HA)

Sign In for Pricing
View Details
Recombinant Human Troponin C (cardiac) Protein
NBP1-72499-50ug 50 µg

Recombinant Human Troponin C (cardiac) Protein

Sign In for Pricing
View Details