Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human C1QTNF3 protein

This Human C1QTNF3 protein spans the amino acid sequence from region 23-246aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Collagenous repeat-containing sequence 26KDA protein , CORS26Secretory protein CORS26

UniProt

Q9BXJ4

Expression Region

23-246aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Metabolism Research

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

28.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

E.coli and Yeast N-terminal 6xHis-tagged Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

QDEYMESPQTGGLPPDCSKCCHGDYSFRGYQGPPGPPGPPGIPGNHGNNGNNGATGHEGAKGEKGDKGDLGPRGERGQHGPKGEKGYPGIPPELQIAFMASLATHFSNQNSGIIFSSVETNIGNFFDVMTGRFGAPVSGVYFFTFSMMKHEDVEEVYVYLMHNGNTVFSMYSYEMKGKSDTSSNHAVLKLAKGDEVWLRMGNGALHGDHQRFSTFAGFLLFETK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

H2BK1 Antibody
KC-18952-01 50 μL

H2BK1 Antibody

Sign In for Pricing
View Details
H2BK1 Antibody
KC-18952-02 100 µL

H2BK1 Antibody

Sign In for Pricing
View Details
H2BK1 Antibody
KC-18952-03 1 mL

H2BK1 Antibody

Sign In for Pricing
View Details
PCMF (KCMF1) Human Gene Knockout Kit (CRISPR)
KN401679 1 Kit

PCMF (KCMF1) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
2,2-Diphenylglycine
TRC-D491620-5G 5 g

2,2-Diphenylglycine

Sign In for Pricing
View Details
ATP6V0B (Center) Rabbit Polyclonal Antibody
AP50303PU-N 400 µL

ATP6V0B (Center) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details