Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human C1QTNF3 protein

This Human C1QTNF3 protein spans the amino acid sequence from region 23-246aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Collagenous repeat-containing sequence 26KDA protein , CORS26Secretory protein CORS26

UniProt

Q9BXJ4

Expression Region

23-246aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Metabolism Research

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

28.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

E.coli and Yeast N-terminal 6xHis-tagged Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

QDEYMESPQTGGLPPDCSKCCHGDYSFRGYQGPPGPPGPPGIPGNHGNNGNNGATGHEGAKGEKGDKGDLGPRGERGQHGPKGEKGYPGIPPELQIAFMASLATHFSNQNSGIIFSSVETNIGNFFDVMTGRFGAPVSGVYFFTFSMMKHEDVEEVYVYLMHNGNTVFSMYSYEMKGKSDTSSNHAVLKLAKGDEVWLRMGNGALHGDHQRFSTFAGFLLFETK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tmc2 Mouse Gene Knockout Kit (CRISPR)
KN517659 1 Kit

Tmc2 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Cytokeratin 19 (KRT19) (Pancreatic Stem Cell Marker) (KRT19/1959R), CF640R conjugate, 0.1mg/mL
BNC401959-100 1x 100 µL

Cytokeratin 19 (KRT19) (Pancreatic Stem Cell Marker) (KRT19/1959R), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Shikimate-3-phosphate Trisodium Salt (90%)
TRC-S357026-1MG 1 mg

Shikimate-3-phosphate Trisodium Salt (90%)

Sign In for Pricing
View Details
Frozen Tissue Sections, Colon
CS631721 5x 5 µm

Frozen Tissue Sections, Colon

Sign In for Pricing
View Details
Midkine (MDK) (NM_001012334) Human Over-expression Lysate
LY423328 100 µg

Midkine (MDK) (NM_001012334) Human Over-expression Lysate

Sign In for Pricing
View Details
Ffar4 Rabbit Polyclonal Antibody
TA397455 100 µg

Ffar4 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details