Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Bacterial cpg2 protein

This Bacterial cpg2 protein spans the amino acid sequence from region 23-415aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Folate hydrolase G2Glutamate carboxypeptidasePteroylmonoglutamic acid hydrolase G2INN, Glucarpidase

UniProt

P06621

Expression Region

23-415aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Pseudomonas sp. (strain RS-16)

Field of Research

Infectious Disease & Virology; Neuroscience

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

68.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

E.coli and Yeast N-terminal GST-tagged Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

ALAQKRDNVLFQAATDEQPAVIKTLEKLVNIETGTGDAEGIAAAGNFLEAELKNLGFTVTRSKSAGLVVGDNIVGKIKGRGGKNLLLMSHMDTVYLKGILAKAPFRVEGDKAYGPGIADDKGGNAVILHTLKLLKEYGVRDYGTITVLFNTDEEKGSFGSRDLIQEEAKLADYVLSFEPTSAGDEKLSLGTSGIAYVQVNITGKASHAGAAPELGVNALVEASDLVLRTMNIDDKAKNLRFNWTIAKAGNVSNIIPASATLNADVRYARNEDFDAAMKTLEERAQQKKLPEADVKVIVTRGRPAFNAGEGGKKLVDKAVAYYKEAGGTLGVEERTGGGTDAAYAALSGKPVIESLGLPGFGYHSDKAEYVDISAIPRRLYMAARLIMDLGAGK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RASGRF1 Rabbit Polyclonal Antibody (BF647)
orb2428809 100 µL

RASGRF1 Rabbit Polyclonal Antibody (BF647)

Sign In for Pricing
View Details
C.I. Mordant Brown 1
T30669-01 100 mg

C.I. Mordant Brown 1

Sign In for Pricing
View Details
C.I. Mordant Brown 1
T30669-02 25 mg

C.I. Mordant Brown 1

Sign In for Pricing
View Details
C.I. Mordant Brown 1
T30669-03 50 mg

C.I. Mordant Brown 1

Sign In for Pricing
View Details
CkIIalpha Antibody
orb804782 2 mg

CkIIalpha Antibody

Sign In for Pricing
View Details
PSDR1 (Prostate Short Chain Dehydrogenase/Reductase 1, Prostate Short-chain Dehydrogenase Reductase, C85936, CGI-82, M42C60, RALR1, Ube-1c, UBE-1c1, 2610319N22Rik, AI428145, Androgen-regulated Short-chain Dehydrogenase/Reductase 1, ARSDR1, AU045252, FLJ32633, HCBP12, HCV Core Binding Protein HCBP12, MDT1, Retinal Reductase 1, Retinol Dehydrogenase 11 (All trans/9 cis/11 cis), SCALD)
P9151-02 100 µg

PSDR1 (Prostate Short Chain Dehydrogenase/Reductase 1, Prostate Short-chain Dehydrogenase Reductase, C85936, CGI-82, M42C60, RALR1, Ube-1c, UBE-1c1, 2610319N22Rik, AI428145, Androgen-regulated Short-chain Dehydrogenase/Reductase 1, ARSDR1, AU045252, FLJ32633, HCBP12, HCV Core Binding Protein HCBP12, MDT1, Retinal Reductase 1, Retinol Dehydrogenase 11 (All trans/9 cis/11 cis), SCALD)

Sign In for Pricing
View Details