Parasite MSA2 protein
This Parasite MSA2 protein spans the amino acid sequence from region 109-246aa. Purity: Greater than 90% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
45KDA merozoite surface antigen
UniProt
P50498
Expression Region
109-246aa
Tag
N-terminal GST-tagged
Source
E.coli
Origin
Plasmodium falciparum (isolate 3D7)
Field of Research
Developmental Biology, Epigenetics
Purity
Greater than 90% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Molecular Weight
41.7 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
Applications Notes
E.coli and Yeast N-terminal GST-tagged Partial
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
AA Sequence
NDAEASTSTSSENPNHKNAETNPKGKGEVQEPNQANKETQNNSNVQQDSQTKSNVPPTQDADTKSPTAQPEQAENSAPTAEQTESPELQSAPENKGTGQHGHMHGSRNNHPQNTSDSQKECTDGNKENCGAATSLLNN
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
![FUBP1 Antibody [E17K24]](https://cdn.genprice.uk/genprice/uk/genprice2.webp)
N2300-60A-ML750 100 µL
NFIL3 (E4 Promoter Binding Protein 4, E4BP4, E4BP4 Protein, Interleukin 3 Binding Protein 1, IL3BP1, Interleukin 3 Promoter Transcriptional Activator, NFIL3A, Nuclear Factor Interleukin 3 Regulated, Transcriptional Activator NF-IL3A) (MaxLight 750) discontinued
Sign In for Pricing
View Details 
MBS3907667-01 0.0025 mg
Rabbit anti-Cyclin E1 IHC Antibody, Affinity Purified
Sign In for Pricing
View Details MBS3907667-02 8 mL
Rabbit anti-Cyclin E1 IHC Antibody, Affinity Purified
Sign In for Pricing
View Details MBS3907667-03 5x 0.0025 mg
Rabbit anti-Cyclin E1 IHC Antibody, Affinity Purified
Sign In for Pricing
View Details