Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human RYR3 protein

This Human RYR3 protein spans the amino acid sequence from region 3934-4181aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Brain ryanodine receptor-calcium release channelBrain-type ryanodine receptorType 3 ryanodine receptor

UniProt

Q15413

Expression Region

3934-4181aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Neuroscience

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

32.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

E.coli and Yeast N-terminal 6xHis-tagged Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

DGKGIISKKEFQKAMEGQKQYTQSEIDFLLSCAEADENDMFNYVDFVDRFHEPAKDIGFNVAVLLTNLSEHMPNDSRLKCLLDPAESVLNYFEPYLGRIEIMGGAKKIERVYFEISESSRTQWEKPQVKESKRQFIFDVVNEGGEQEKMELFVNFCEDTIFEMQLASQISESDSADRPEEEEEDEDSSYVLEIAGEEEEDGSLEPASAFAMACASVKRNVTDFLKRATLKNLRKQYRNVKKMTAKELV

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

MAP2 Mouse Monoclonal Antibody (APC-Cy7)
orb2369525 100 µL

MAP2 Mouse Monoclonal Antibody (APC-Cy7)

Sign In for Pricing
View Details
Recombinant Drosophila melanogaster Histone chaperone asf1 (asf1)
MBS1343684-01 0.02 mg (E-Coli)

Recombinant Drosophila melanogaster Histone chaperone asf1 (asf1)

Sign In for Pricing
View Details
Recombinant Drosophila melanogaster Histone chaperone asf1 (asf1)
MBS1343684-02 0.1 mg (E-Coli)

Recombinant Drosophila melanogaster Histone chaperone asf1 (asf1)

Sign In for Pricing
View Details
Recombinant Drosophila melanogaster Histone chaperone asf1 (asf1)
MBS1343684-03 0.02 mg (Yeast)

Recombinant Drosophila melanogaster Histone chaperone asf1 (asf1)

Sign In for Pricing
View Details
Recombinant Drosophila melanogaster Histone chaperone asf1 (asf1)
MBS1343684-04 0.1 mg (Yeast)

Recombinant Drosophila melanogaster Histone chaperone asf1 (asf1)

Sign In for Pricing
View Details
Recombinant Drosophila melanogaster Histone chaperone asf1 (asf1)
MBS1343684-05 0.02 mg (Baculovirus)

Recombinant Drosophila melanogaster Histone chaperone asf1 (asf1)

Sign In for Pricing
View Details