Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse RES protein

This Mouse RES protein spans the amino acid sequence from region 21-114aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Adipose tissue-specific secretory factor , ADSFAdipose-specific cysteine-rich secreted protein A12-alpha, Cysteine-rich secreted protein FIZZ3

UniProt

Q99P87

Expression Region

21-114aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Epigenetics

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

14.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

E.coli and Yeast N-terminal 6xHis-tagged Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

SSMPLCPIDEAIDKKIKQDFNSLFPNAIKNIGLNCWTVSSRGKLASCPEGTAVLSCSCGSACGSWDIREEKVCHCQCARIDWTAARCCKLQVAS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Anti SMAD5 Polyclonal Affinity Purified (PBS with 0.02% sodium azide, 50% glycerol, pH7.3) (IHC,Immunofluorescence)
IRBAMLSMAD5AP517120UL 1 Each

Rabbit Anti SMAD5 Polyclonal Affinity Purified (PBS with 0.02% sodium azide, 50% glycerol, pH7.3) (IHC,Immunofluorescence)

Sign In for Pricing
View Details
DIS3 Protein Vector (Rat) (pPB-N-His)
PV264115 500 ng

DIS3 Protein Vector (Rat) (pPB-N-His)

Sign In for Pricing
View Details
Recombinant Frankia sp. ATP synthase subunit b (atpF)
MBS7009621-01 0.02 mg

Recombinant Frankia sp. ATP synthase subunit b (atpF)

Sign In for Pricing
View Details
Recombinant Frankia sp. ATP synthase subunit b (atpF)
MBS7009621-02 0.1 mg

Recombinant Frankia sp. ATP synthase subunit b (atpF)

Sign In for Pricing
View Details
Recombinant Frankia sp. ATP synthase subunit b (atpF)
MBS7009621-03 5x 0.1 mg

Recombinant Frankia sp. ATP synthase subunit b (atpF)

Sign In for Pricing
View Details
APOM (Apolipoprotein M)
475460 100 µL

APOM (Apolipoprotein M)

Sign In for Pricing
View Details