Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human MMP3 protein

This Human MMP3 protein spans the amino acid sequence from region 102-477aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Matrix metalloproteinase-3 , MMP-3Transin-1

UniProt

P08254

Expression Region

102-477aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

58.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

E.coli and Yeast N-terminal 6xHis-SUMO-tagged Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

TFPGIPKWRKTHLTYRIVNYTPDLPKDAVDSAVEKALKVWEEVTPLTFSRLYEGEADIMISFAVREHGDFYPFDGPGNVLAHAYAPGPGINGDAHFDDDEQWTKDTTGTNLFLVAAHEIGHSLGLFHSANTEALMYPLYHSLTDLTRFRLSQDDINGIQSLYGPPPDSPETPLVPTEPVPPEPGTPANCDPALSFDAVSTLRGEILIFKDRHFWRKSLRKLEPELHLISSFWPSLPSGVDAAYEVTSKDLVFIFKGNQFWAIRGNEVRAGYPRGIHTLGFPPTVRKIDAAISDKEKNKTYFFVEDKYWRFDEKRNSMEPGFPKQIAEDFPGIDSKIDAVFEEFGFFYFFTGSSQLEFDPNAKKVTHTLKSNSWLNC

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FAM118B (C-11) Alexa Fluor® 488
sc-514039 AF488 200 µg/mL

FAM118B (C-11) Alexa Fluor® 488

Sign In for Pricing
View Details
ZC4H2 siRNA (Human)
CRJ1005-01 15 nmol

ZC4H2 siRNA (Human)

Sign In for Pricing
View Details
ZC4H2 siRNA (Human)
CRJ1005-02 30 nmol

ZC4H2 siRNA (Human)

Sign In for Pricing
View Details
1-Chloro-1-propene
sc-485597 10 mL

1-Chloro-1-propene

Sign In for Pricing
View Details
Canine Interleukin-4 receptor subunit alpha (IL4R) ELISA Kit
MBS7211033-01 48 Well

Canine Interleukin-4 receptor subunit alpha (IL4R) ELISA Kit

Sign In for Pricing
View Details
Canine Interleukin-4 receptor subunit alpha (IL4R) ELISA Kit
MBS7211033-02 96 Well

Canine Interleukin-4 receptor subunit alpha (IL4R) ELISA Kit

Sign In for Pricing
View Details