Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human MMP14 protein

This Human MMP14 protein spans the amino acid sequence from region 112-582aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

MMP-X1Membrane-type matrix metalloproteinase 1 , MT-MMP 1 , MTMMP1Membrane-type-1 matrix metalloproteinase , MT1-MMP , MT1MMP

UniProt

P50281

Expression Region

112-582aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Cancer Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

69.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

E.coli and Yeast N-terminal 6xHis-SUMO-tagged Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

YAIQGLKWQHNEITFCIQNYTPKVGEYATYEAIRKAFRVWESATPLRFREVPYAYIREGHEKQADIMIFFAEGFHGDSTPFDGEGGFLAHAYFPGPNIGGDTHFDSAEPWTVRNEDLNGNDIFLVAVHELGHALGLEHSSDPSAIMAPFYQWMDTENFVLPDDDRRGIQQLYGGESGFPTKMPPQPRTTSRPSVPDKPKNPTYGPNICDGNFDTVAMLRGEMFVFKERWFWRVRNNQVMDGYPMPIGQFWRGLPASINTAYERKDGKFVFFKGDKHWVFDEASLEPGYPKHIKELGRGLPTDKIDAALFWMPNGKTYFFRGNKYYRFNEELRAVDSEYPKNIKVWEGIPESPRGSFMGSDEVFTYFYKGNKYWKFNNQKLKVEPGYPKSALRDWMGCPSGGRPDEGTEEETEVIIIEVDEEGGGAVSAAAVVLPVLLLLLVLAVGLAVFFFRRHGTPRRLLYCQRSLLDKV

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

TMPRSS7 Antibody, HRP conjugated
A58407-50UG 50 µg

TMPRSS7 Antibody, HRP conjugated

Sign In for Pricing
View Details
AGPAT5 Antibody, Biotin conjugated
MBS7103330-01 0.05 mg

AGPAT5 Antibody, Biotin conjugated

Sign In for Pricing
View Details
AGPAT5 Antibody, Biotin conjugated
MBS7103330-02 0.1 mg

AGPAT5 Antibody, Biotin conjugated

Sign In for Pricing
View Details
AGPAT5 Antibody, Biotin conjugated
MBS7103330-03 5x 0.1 mg

AGPAT5 Antibody, Biotin conjugated

Sign In for Pricing
View Details
hsa-miR-4644 miRNA Inhibitor
MIH02472 2x 5.0 nmol

hsa-miR-4644 miRNA Inhibitor

Sign In for Pricing
View Details
Recombinant Human IgA-inducing protein homolog (IGIP)
RPC28133-01 20 µg

Recombinant Human IgA-inducing protein homolog (IGIP)

Sign In for Pricing
View Details