Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human MMP14 protein

This Human MMP14 protein spans the amino acid sequence from region 112-582aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

MMP-X1Membrane-type matrix metalloproteinase 1 , MT-MMP 1 , MTMMP1Membrane-type-1 matrix metalloproteinase , MT1-MMP , MT1MMP

UniProt

P50281

Expression Region

112-582aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Cancer Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

69.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

E.coli and Yeast N-terminal 6xHis-SUMO-tagged Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

YAIQGLKWQHNEITFCIQNYTPKVGEYATYEAIRKAFRVWESATPLRFREVPYAYIREGHEKQADIMIFFAEGFHGDSTPFDGEGGFLAHAYFPGPNIGGDTHFDSAEPWTVRNEDLNGNDIFLVAVHELGHALGLEHSSDPSAIMAPFYQWMDTENFVLPDDDRRGIQQLYGGESGFPTKMPPQPRTTSRPSVPDKPKNPTYGPNICDGNFDTVAMLRGEMFVFKERWFWRVRNNQVMDGYPMPIGQFWRGLPASINTAYERKDGKFVFFKGDKHWVFDEASLEPGYPKHIKELGRGLPTDKIDAALFWMPNGKTYFFRGNKYYRFNEELRAVDSEYPKNIKVWEGIPESPRGSFMGSDEVFTYFYKGNKYWKFNNQKLKVEPGYPKSALRDWMGCPSGGRPDEGTEEETEVIIIEVDEEGGGAVSAAAVVLPVLLLLLVLAVGLAVFFFRRHGTPRRLLYCQRSLLDKV

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

FBXO47 Protein Vector (Mouse) (pPB-N-His)
PV178743 500 ng

FBXO47 Protein Vector (Mouse) (pPB-N-His)

Sign In for Pricing
View Details
TMEM132B CRISPR All-in-one AAV vector set (with saCas9)(Human)
46888151 3x 1.0 µg DNA

TMEM132B CRISPR All-in-one AAV vector set (with saCas9)(Human)

Sign In for Pricing
View Details
Influenza A H1N1 (A/California/04/2009) Hemagglutinin/HA Antibody, Rabbit PAb
MBS8104738-01 0.02 mL

Influenza A H1N1 (A/California/04/2009) Hemagglutinin/HA Antibody, Rabbit PAb

Sign In for Pricing
View Details
Influenza A H1N1 (A/California/04/2009) Hemagglutinin/HA Antibody, Rabbit PAb
MBS8104738-02 0.1 mL

Influenza A H1N1 (A/California/04/2009) Hemagglutinin/HA Antibody, Rabbit PAb

Sign In for Pricing
View Details
Influenza A H1N1 (A/California/04/2009) Hemagglutinin/HA Antibody, Rabbit PAb
MBS8104738-03 5x 0.1 mL

Influenza A H1N1 (A/California/04/2009) Hemagglutinin/HA Antibody, Rabbit PAb

Sign In for Pricing
View Details
Cyclic diguanosine monophosphorodithioate, Rp- isomers (Rp, Rp-c-diGMPSS), sodium salt
C 129-001 0.1 µmol ~ 72 µg

Cyclic diguanosine monophosphorodithioate, Rp- isomers (Rp, Rp-c-diGMPSS), sodium salt

Sign In for Pricing
View Details