Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human MMP14 protein

This Human MMP14 protein spans the amino acid sequence from region 112-582aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

MMP-X1Membrane-type matrix metalloproteinase 1 , MT-MMP 1 , MTMMP1Membrane-type-1 matrix metalloproteinase , MT1-MMP , MT1MMP

UniProt

P50281

Expression Region

112-582aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Cancer Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

69.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

E.coli and Yeast N-terminal 6xHis-SUMO-tagged Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

YAIQGLKWQHNEITFCIQNYTPKVGEYATYEAIRKAFRVWESATPLRFREVPYAYIREGHEKQADIMIFFAEGFHGDSTPFDGEGGFLAHAYFPGPNIGGDTHFDSAEPWTVRNEDLNGNDIFLVAVHELGHALGLEHSSDPSAIMAPFYQWMDTENFVLPDDDRRGIQQLYGGESGFPTKMPPQPRTTSRPSVPDKPKNPTYGPNICDGNFDTVAMLRGEMFVFKERWFWRVRNNQVMDGYPMPIGQFWRGLPASINTAYERKDGKFVFFKGDKHWVFDEASLEPGYPKHIKELGRGLPTDKIDAALFWMPNGKTYFFRGNKYYRFNEELRAVDSEYPKNIKVWEGIPESPRGSFMGSDEVFTYFYKGNKYWKFNNQKLKVEPGYPKSALRDWMGCPSGGRPDEGTEEETEVIIIEVDEEGGGAVSAAAVVLPVLLLLLVLAVGLAVFFFRRHGTPRRLLYCQRSLLDKV

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-LRAT antibody
PAab04838 100 µg

Anti-LRAT antibody

Sign In for Pricing
View Details
Rabbit Anti Human MMP7 Polyclonal Affinity Purified (PBS with 0.05% sodium azide and 50% glycerol, pH7.4) (Western Blot,ELISA) 120ul
IRBAHUMMP7AP062120UL 120 µL

Rabbit Anti Human MMP7 Polyclonal Affinity Purified (PBS with 0.05% sodium azide and 50% glycerol, pH7.4) (Western Blot,ELISA) 120ul

Sign In for Pricing
View Details
UGT2B4 Polyclonal Antibody
RD89610A-01 60 μL

UGT2B4 Polyclonal Antibody

Sign In for Pricing
View Details
UGT2B4 Polyclonal Antibody
RD89610A-02 120 μL

UGT2B4 Polyclonal Antibody

Sign In for Pricing
View Details
UGT2B4 Polyclonal Antibody
RD89610A-03 200 µL

UGT2B4 Polyclonal Antibody

Sign In for Pricing
View Details
ZNF596 Colorimetric Cell-Based ELISA
EKC1880 1 Kit, containing one 96 Well Plate and all necessary reagents

ZNF596 Colorimetric Cell-Based ELISA

Sign In for Pricing
View Details