Human KCND1 protein
This Human KCND1 protein spans the amino acid sequence from region 410-647aa. Purity: Greater than 90% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
Voltage-gated potassium channel subunit Kv4.1
UniProt
Q9NSA2
Expression Region
410-647aa
Tag
N-terminal 6xHis-tagged
Source
E.coli
Origin
Homo sapiens (Human)
Field of Research
Neuroscience
Purity
Greater than 90% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Molecular Weight
29.7 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
Applications Notes
E.coli and Yeast N-terminal 6xHis-tagged Cytoplasmic Domain
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
AA Sequence
NFSRIYHQNQRADKRRAQQKVRLARIRLAKSGTTNAFLQYKQNGGLEDSGSGEEQALCVRNRSAFEQQHHHLLHCLEKTTCHEFTDELTFSEALGAVSPGGRTSRSTSVSSQPVGPGSLLSSCCPRRAKRRAIRLANSTASVSRGSMQELDMLAGLRRSHAPQSRSSLNAKPHDSLDLNCDSRDFVAAIISIPTPPANTPDESQPSSPGGGGRAGSTLRNSSLGTPCLFPETVKISSL
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS6309600-01 0.2 mL
IGSF6, ID (IGSF6, DORA, Immunoglobulin superfamily member 6, Protein DORA) (Azide free) (HRP)
Sign In for Pricing
View Details MBS6309600-02 5x 0.2 mL
IGSF6, ID (IGSF6, DORA, Immunoglobulin superfamily member 6, Protein DORA) (Azide free) (HRP)
Sign In for Pricing
View Details 
MBS1147501-01 0.05 mg (E-Coli)
Recombinant Dictyostelium discoideum DNA-directed RNA polymerase II subunit rpb1 (polr2a), partial
Sign In for Pricing
View Details MBS1147501-02 0.05 mg (Yeast)
Recombinant Dictyostelium discoideum DNA-directed RNA polymerase II subunit rpb1 (polr2a), partial
Sign In for Pricing
View Details MBS1147501-03 0.2 mg (E-Coli)
Recombinant Dictyostelium discoideum DNA-directed RNA polymerase II subunit rpb1 (polr2a), partial
Sign In for Pricing
View Details