Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human KCND1 protein

This Human KCND1 protein spans the amino acid sequence from region 410-647aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Voltage-gated potassium channel subunit Kv4.1

UniProt

Q9NSA2

Expression Region

410-647aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Neuroscience

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

29.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

E.coli and Yeast N-terminal 6xHis-tagged Cytoplasmic Domain

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

NFSRIYHQNQRADKRRAQQKVRLARIRLAKSGTTNAFLQYKQNGGLEDSGSGEEQALCVRNRSAFEQQHHHLLHCLEKTTCHEFTDELTFSEALGAVSPGGRTSRSTSVSSQPVGPGSLLSSCCPRRAKRRAIRLANSTASVSRGSMQELDMLAGLRRSHAPQSRSSLNAKPHDSLDLNCDSRDFVAAIISIPTPPANTPDESQPSSPGGGGRAGSTLRNSSLGTPCLFPETVKISSL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human CRHR2 shRNA (UAS) - Lentiviral human CRHR2 shRNA (UAS) (25)
GTR15154721 1 Vial

Lentiviral human CRHR2 shRNA (UAS) - Lentiviral human CRHR2 shRNA (UAS) (25)

Sign In for Pricing
View Details
Recombinant Mouse Claudin-11 (Cldn11)
MBS7011557-01 0.02 mg

Recombinant Mouse Claudin-11 (Cldn11)

Sign In for Pricing
View Details
Recombinant Mouse Claudin-11 (Cldn11)
MBS7011557-02 0.1 mg

Recombinant Mouse Claudin-11 (Cldn11)

Sign In for Pricing
View Details
Recombinant Mouse Claudin-11 (Cldn11)
MBS7011557-03 5x 0.1 mg

Recombinant Mouse Claudin-11 (Cldn11)

Sign In for Pricing
View Details
DNAJC7 (DnaJ Homolog Subfamily C Member 7, Tetratricopeptide Repeat Protein 2, TPR rEpeat Protein 2, TPR2, TTC2)
125950 50 µg

DNAJC7 (DnaJ Homolog Subfamily C Member 7, Tetratricopeptide Repeat Protein 2, TPR rEpeat Protein 2, TPR2, TTC2)

Sign In for Pricing
View Details
Lentiviral human FABP1 shRNA (UAS) - Lentiviral human FABP1 shRNA (UAS, iRFP) (25)
GTR15149834 1 Vial

Lentiviral human FABP1 shRNA (UAS) - Lentiviral human FABP1 shRNA (UAS, iRFP) (25)

Sign In for Pricing
View Details