Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human KCNA1 protein

This Human KCNA1 protein spans the amino acid sequence from region 1-154aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Voltage-gated K (+) channel HuKI1

UniProt

Q09470

Expression Region

1-154aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

22.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

E.coli and Yeast N-terminal 6xHis-tagged Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MTVMSGENVDEASAAPGHPQDGSYPRQADHDDHECCERVVINISGLRFETQLKTLAQFPNTLLGNPKKRMRYFDPLRNEYFFDRNRPSFDAILYYYQSGGRLRRPVNVPLDMFSEEIKFYELGEEAMEKFREDEGFIKEEERPLPEKEYQRQVW

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Uncoated Human SOST (Sclerostin) ELISA Kit
E-UNEL-H0364-01 5x 96 Tests

Uncoated Human SOST (Sclerostin) ELISA Kit

Sign In for Pricing
View Details
Uncoated Human SOST (Sclerostin) ELISA Kit
E-UNEL-H0364-02 15x 96 Tests

Uncoated Human SOST (Sclerostin) ELISA Kit

Sign In for Pricing
View Details
Heparan Sulphate Proteoglycan (A7L6), Biotin conjugate, 0.1mg/mL
BNCB0315-100 1x 100 µL

Heparan Sulphate Proteoglycan (A7L6), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
PE/Elab Fluor® 594 Rat IgG1, κ Isotype Control[HRPN]
E-AB-F09823P-01 25 µg

PE/Elab Fluor® 594 Rat IgG1, κ Isotype Control[HRPN]

Sign In for Pricing
View Details
PE/Elab Fluor® 594 Rat IgG1, κ Isotype Control[HRPN]
E-AB-F09823P-02 100 µg

PE/Elab Fluor® 594 Rat IgG1, κ Isotype Control[HRPN]

Sign In for Pricing
View Details
Recombinant HIV-1 gp140 Protein (group M, subtype CRF07_BC) (Fc Tag)
PKSV030187 100 µg

Recombinant HIV-1 gp140 Protein (group M, subtype CRF07_BC) (Fc Tag)

Sign In for Pricing
View Details