Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human FCER1G protein

This Human FCER1G protein spans the amino acid sequence from region 19-86aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Fc receptor gamma-chain , FcRgammaFc-epsilon RI-gammaIgE Fc receptor subunit gamma , FceRI gamma

UniProt

P30273

Expression Region

19-86aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

34.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

E.coli and Yeast N-terminal GST-tagged Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

LGEPQLCYILDAILFLYGIVLTLLYCRLKIQVRKAAITSYEKSDGVYTGLSTRNQETYETLKHEKPPQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GRB10 (NM_001001550) Human Recombinant Protein
TP320822L 1 mg

GRB10 (NM_001001550) Human Recombinant Protein

Sign In for Pricing
View Details
SIRT2 (NM_012237) Human Over-expression Lysate
LC402172 20 µg

SIRT2 (NM_012237) Human Over-expression Lysate

Sign In for Pricing
View Details
4-Bromo-2-picoline
TRC-B685560-250MG 250 mg

4-Bromo-2-picoline

Sign In for Pricing
View Details
Piccolo (PCLO) Mouse Monoclonal Antibody [Clone ID: PCLO-01]
AM26707PU-N 100 µg

Piccolo (PCLO) Mouse Monoclonal Antibody [Clone ID: PCLO-01]

Sign In for Pricing
View Details
CD21 (Mature B-Cell & Follicular Dendritic Cell Marker) (CR2/2754), CF647 conjugate, 0.1mg/mL
BNC472754-500 1x 500 µL

CD21 (Mature B-Cell & Follicular Dendritic Cell Marker) (CR2/2754), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CF®750-Dextran 40,000 MW, Anionic and Fixable
#80128 1x 1 mg

CF®750-Dextran 40,000 MW, Anionic and Fixable

Sign In for Pricing
View Details