What is the catalog number for Human CTSK protein?

The catalog number for Human CTSK protein is orb382948.

What sizes are available for Human CTSK protein?

Human CTSK protein is available in the following size(s): 20 µg, 100 µg, 1 mg.

How many pack sizes does Human CTSK protein come in?

Human CTSK protein is available in 3 different pack sizes.

Is Human CTSK protein in stock?

Human CTSK protein is currently made to order / not held in immediate stock. Contact us for lead time.

Human CTSK protein

This Human CTSK protein spans the amino acid sequence from region 115-329aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Cathepsin OCathepsin O2, Cathepsin X

UniProt

P43235

Expression Region

115-329aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

27.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

E.coli and Yeast N-terminal 6xHis-tagged Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

APDSVDYRKKGYVTPVKNQGQCGSCWAFSSVGALEGQLKKKTGKLLNLSPQNLVDCVSENDGCGGGYMTNAFQYVQKNRGIDSEDAYPYVGQEESCMYNPTGKAAKCRGYREIPEGNEKALKRAVARVGPVSVAIDASLTSFQFYSKGVYYDESCNSDNLNHAVLAVGYGIQKGNKHWIIKNSWGENWGNKGYILMARNKNNACGIANLASFPKM