Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human CTSK protein

This Human CTSK protein spans the amino acid sequence from region 115-329aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Cathepsin OCathepsin O2, Cathepsin X

UniProt

P43235

Expression Region

115-329aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

27.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

E.coli and Yeast N-terminal 6xHis-tagged Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

APDSVDYRKKGYVTPVKNQGQCGSCWAFSSVGALEGQLKKKTGKLLNLSPQNLVDCVSENDGCGGGYMTNAFQYVQKNRGIDSEDAYPYVGQEESCMYNPTGKAAKCRGYREIPEGNEKALKRAVARVGPVSVAIDASLTSFQFYSKGVYYDESCNSDNLNHAVLAVGYGIQKGNKHWIIKNSWGENWGNKGYILMARNKNNACGIANLASFPKM

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ca5b (NM_001005551) Rat Tagged ORF Clone
RR209384 10 µg

Ca5b (NM_001005551) Rat Tagged ORF Clone

Sign In for Pricing
View Details
Recombinant Human PRSS3 Protein, His (Fc)-Avi-tagged
PRSS3-3927H 50 µg

Recombinant Human PRSS3 Protein, His (Fc)-Avi-tagged

Sign In for Pricing
View Details
Lentiviral mouse Fam199x shRNA (UAS) - Lentiviral mouse Fam199x shRNA (UAS, RFP) (25)
GTR15275099 1 Vial

Lentiviral mouse Fam199x shRNA (UAS) - Lentiviral mouse Fam199x shRNA (UAS, RFP) (25)

Sign In for Pricing
View Details
5830403L16Rik Lentiviral Activation Particles (m)
sc-433793-LAC 200 µL

5830403L16Rik Lentiviral Activation Particles (m)

Sign In for Pricing
View Details
RASSF5 Polyclonal Conjugated Antibody
C30913 100 µL

RASSF5 Polyclonal Conjugated Antibody

Sign In for Pricing
View Details
Anti-Zebrafish DAPK2A Antibody Picoband®
AZE7F1A1 100 µg/Vial

Anti-Zebrafish DAPK2A Antibody Picoband®

Sign In for Pricing
View Details