Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human CTSK protein

This Human CTSK protein spans the amino acid sequence from region 115-329aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Cathepsin OCathepsin O2, Cathepsin X

UniProt

P43235

Expression Region

115-329aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

27.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

E.coli and Yeast N-terminal 6xHis-tagged Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

APDSVDYRKKGYVTPVKNQGQCGSCWAFSSVGALEGQLKKKTGKLLNLSPQNLVDCVSENDGCGGGYMTNAFQYVQKNRGIDSEDAYPYVGQEESCMYNPTGKAAKCRGYREIPEGNEKALKRAVARVGPVSVAIDASLTSFQFYSKGVYYDESCNSDNLNHAVLAVGYGIQKGNKHWIIKNSWGENWGNKGYILMARNKNNACGIANLASFPKM

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

PIGZ CytoSection
TS408313P5 25 Slides

PIGZ CytoSection

Sign In for Pricing
View Details
Beta Amyloid Recombinant Rabbit monoclonal Antibody
HA722961 100 µL

Beta Amyloid Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
AK4 siRNA (m)
sc-38909 10 µM

AK4 siRNA (m)

Sign In for Pricing
View Details
Glucose/Maltose
MA-0317 100 Well

Glucose/Maltose

Sign In for Pricing
View Details
EGR3 Peptide - middle region
MBS3226921-01 0.1 mg

EGR3 Peptide - middle region

Sign In for Pricing
View Details
EGR3 Peptide - middle region
MBS3226921-02 5x 0.1 mg

EGR3 Peptide - middle region

Sign In for Pricing
View Details