Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human CDC25C protein

This Human CDC25C protein spans the amino acid sequence from region 1-473aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Dual specificity phosphatase Cdc25C

UniProt

P30307

Expression Region

1-473aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

57.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

E.coli and Yeast N-terminal 6xHis-tagged Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MSTELFSSTREEGSSGSGPSFRSNQRKMLNLLLERDTSFTVCPDVPRTPVGKFLGDSANLSILSGGTPKRCLDLSNLSSGEITATQLTTSADLDETGHLDSSGLQEVHLAGMNHDQHLMKCSPAQLLCSTPNGLDRGHRKRDAMCSSSANKENDNGNLVDSEMKYLGSPITTVPKLDKNPNLGEDQAEEISDELMEFSLKDQEAKVSRSGLYRSPSMPENLNRPRLKQVEKFKDNTIPDKVKKKYFSGQGKLRKGLCLKKTVSLCDITITQMLEEDSNQGHLIGDFSKVCALPTVSGKHQDLKYVNPETVAALLSGKFQGLIEKFYVIDCRYPYEYLGGHIQGALNLYSQEELFNFFLKKPIVPLDTQKRIIIVFHCEFSSERGPRMCRCLREEDRSLNQYPALYYPELYILKGGYRDFFPEYMELCEPQSYCPMHHQDHKTELLRCRSQSKVQEGERQLREQIALLVKDMSP

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

CHUK Rabbit pAb
MBS9148645-01 0.02 mL

CHUK Rabbit pAb

Sign In for Pricing
View Details
CHUK Rabbit pAb
MBS9148645-02 0.1 mL

CHUK Rabbit pAb

Sign In for Pricing
View Details
CHUK Rabbit pAb
MBS9148645-03 5x 0.1 mL

CHUK Rabbit pAb

Sign In for Pricing
View Details
CD1a (C1A/711), CF488A conjugate, 0.1mg/mL
BNC880711-100 1x 100 µL

CD1a (C1A/711), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
EFHD1 AAV siRNA Pooled Vector
19012161 1.0 µg

EFHD1 AAV siRNA Pooled Vector

Sign In for Pricing
View Details
CDMP1 Polyclonal Antibody, Biotin Conjugated
bs-6580R-Biotin 100 µL

CDMP1 Polyclonal Antibody, Biotin Conjugated

Sign In for Pricing
View Details