Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human CASP14 protein

This Human CASP14 protein spans the amino acid sequence from region 153-240aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Apoptosis related cysteine protease, CASP 14, CASP-14, CASP14, Caspase 14 apoptosis related cysteine protease, Caspase 14 precursor, Caspase-14 subunit p10, Caspase14, CASPE_HUMAN, MGC119078, MGC119079, MICE, Mini ICE

UniProt

P31944

Expression Region

153-240aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Stem Cell & Developmental Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

37.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

E.coli and Yeast N-terminal GST-tagged Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

KDSPQTIPTYTDALHVYSTVEGYIAYRHDQKGSCFIQTLVDVFTKRKGHILELLTEVTRRMAEAELVQEGKARKTNPEIQSTLRKRLY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GENLISA™ Human Coagulation Factor X (F10) ELISA
KBH1185 1x 96 Well

GENLISA™ Human Coagulation Factor X (F10) ELISA

Sign In for Pricing
View Details
IMS2186
573447 5.0mg

IMS2186

Sign In for Pricing
View Details
Lentiviral human COX7A1 sgRNA gene knockout kit - Lentiviral human COX7A1 sgRNA gene knockout kit (100)
GTR15361099 1 Vial

Lentiviral human COX7A1 sgRNA gene knockout kit - Lentiviral human COX7A1 sgRNA gene knockout kit (100)

Sign In for Pricing
View Details
Recombinant Integrin Beta 2 (CD18)
TRV-0012542-01 10 µg

Recombinant Integrin Beta 2 (CD18)

Sign In for Pricing
View Details
Recombinant Integrin Beta 2 (CD18)
TRV-0012542-02 50 µg

Recombinant Integrin Beta 2 (CD18)

Sign In for Pricing
View Details
Recombinant Integrin Beta 2 (CD18)
TRV-0012542-03 100 µg

Recombinant Integrin Beta 2 (CD18)

Sign In for Pricing
View Details