Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse DHH protein (Active)

This Mouse DHH protein (Active) spans the amino acid sequence from region 24-198aa. Purity: > 98% as determined by SDS-PAGE and HPLC.

Product Specifications

Product Name Alternative

DHH

UniProt

Q61488

Expression Region

24-198aa

Tag

Tag-Free

Source

E.Coli

Origin

Mus musculus (Mouse)

Field of Research

Cell Biology

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

> 98% as determined by SDS­PAGE and HPLC.

Bioactivity

Fully biologically active when compared to standard. The ED50 as determined by its ability to induce alkaline phosphatase production by murine MC3T3­E1 cells is 5­20 μg/ml.

Form

Lyophilized powder

Molecular Weight

20.0 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

Lyophilized from a 0.2 μm filtered PBS, pH 7.4,1 mM DTT, 0.05 % Tween-80

AA Sequence

IIGPGRGPVGRRRYVRKQLVPLLYKQFVPSMPERTLGASGPAEGRVTRGSERFRDLVPNYNPDIIFKDEENSGADRLMTERCKERVNALAIAVMNMWPGVRLRVTEGWDEDGHHAQDSLHYEGRALDITTSDRDRNKYGLLARLAVEAGFDWVYYESRNHIHVSVKADNSLAVRAGG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Mouse CASP8 Protein, N-His
orb3055431-01 50 µg

Recombinant Mouse CASP8 Protein, N-His

Sign In for Pricing
View Details
Recombinant Mouse CASP8 Protein, N-His
orb3055431-02 100 µg

Recombinant Mouse CASP8 Protein, N-His

Sign In for Pricing
View Details
Recombinant Mouse CASP8 Protein, N-His
orb3055431-03 1 mg

Recombinant Mouse CASP8 Protein, N-His

Sign In for Pricing
View Details
Aquaporin 1 Rabbit Monoclonal Antibody [KD Validation]
E51K4311 40 µL

Aquaporin 1 Rabbit Monoclonal Antibody [KD Validation]

Sign In for Pricing
View Details
NDRG4 shRNA Plasmid (h)
sc-93374-SH 20 µg

NDRG4 shRNA Plasmid (h)

Sign In for Pricing
View Details
N, N-Dichlorourethane
sc-228751 25 g

N, N-Dichlorourethane

Sign In for Pricing
View Details