Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse CTF1 protein (Active)

This Mouse CTF1 protein (Active) spans the amino acid sequence from region 1-203aa. Purity: > 95% as determined by SDS-PAGE and HPLC.

Product Specifications

Product Name Alternative

CT-1

UniProt

Q60753

Expression Region

1-203aa

Tag

Tag-Free

Source

E.Coli

Origin

Mus musculus (Mouse)

Field of Research

Immunology & Inflammation

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

> 95% as determined by SDS­PAGE and HPLC.

Bioactivity

Fully biologically active when compared to standard. The ED50 as determined by a cell proliferation assay using human TF­1 cells is less than 0.5 ng/ml, corresponding to a specific activity of > 2.0 x 10 ^ 6 IU/mg.

Form

Lyophilized powder

Molecular Weight

21.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

Lyophilized from a 0.2 μm filtered 20 mM PB, pH 7.4, 150mM NaCl

AA Sequence

MSQREGSLEDHQTDSSISFLPHLEAKIRQTHNLARLLTKYAEQLLEEYVQQQGEPFGLPGFSPPRLPLAGLSGPAPSHAGLPVSERLRQDAAALSVLPALLDAVRRRQAELNPRAPRLLRSLEDAARQVRALGAAVETVLAALGAAARGPGPEPVTVATLFTANSTAGIFSAKVLGFHVCGLYGEWVSRTEGDLGQLVPGGVA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FGFR1-Y307 Antibody
orb1427075-01 50 µL

FGFR1-Y307 Antibody

Sign In for Pricing
View Details
FGFR1-Y307 Antibody
orb1427075-02 100 µL

FGFR1-Y307 Antibody

Sign In for Pricing
View Details
DUSP10 Antibody
A19344-100UG 100 µg

DUSP10 Antibody

Sign In for Pricing
View Details
Rabbit BECN1 (Beclin 1)ELISA Kit
MBS2508736-01 24 Tests

Rabbit BECN1 (Beclin 1)ELISA Kit

Sign In for Pricing
View Details
Rabbit BECN1 (Beclin 1)ELISA Kit
MBS2508736-02 48 Tests

Rabbit BECN1 (Beclin 1)ELISA Kit

Sign In for Pricing
View Details
Rabbit BECN1 (Beclin 1)ELISA Kit
MBS2508736-03 96 Tests

Rabbit BECN1 (Beclin 1)ELISA Kit

Sign In for Pricing
View Details