Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human TNFL9 protein (Active)

This Human TNFL9 protein (Active) spans the amino acid sequence from region 71-254aa. Purity: > 95% as determined by SDS-PAGE and HPLC.

Product Specifications

Product Name Alternative

4-1BB ligand

UniProt

P41273

Expression Region

71-254aa

Tag

Tag-Free

Source

E.Coli

Origin

Homo sapiens (Human)

Field of Research

Cancer Biology

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

> 95% as determined by SDS­PAGE and HPLC.

Bioactivity

Fully biologically active when compared to standard. The ED50 as determined by stimulation of IL­8 production using human PBMC is less than 10 ng/ml, corresponding to a specific activity of > 1.0 x 10 ^ 5 IU/mg.

Form

Lyophilized powder

Molecular Weight

19.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

Lyophilized from a 0.2 μm filtered PBS, pH 7.4

AA Sequence

REGPELSPDDPAGLLDLRQGMFAQLVAQNVLLIDGPLSWYSDPGLAGVSLTGGLSYKEDTKELVVAKAGVYYVFFQLELRRVVAGEGSGSVSLALHLQPLRSAAGAAALALTVDLPPASSEARNSAFGFQGRLLHLSAGQRLGVHLHTEARARHAWQLTQGATVLGLFRVTPEIPAGLPSPRSE

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

RASSF6 Rabbit pAb, PE-Cy5.5 conjugated
orb2855720 100 µL

RASSF6 Rabbit pAb, PE-Cy5.5 conjugated

Sign In for Pricing
View Details
4,5,5,5-Tetrafluoro-4- (heptafluoropropoxy) pent-2-enoic acid
PC107495 1 Each

4,5,5,5-Tetrafluoro-4- (heptafluoropropoxy) pent-2-enoic acid

Sign In for Pricing
View Details
Tissue, Control Genomic DNA, Hamster Adult Normal, Female, BioGenomicsTM
T5595-0917T 100 µg

Tissue, Control Genomic DNA, Hamster Adult Normal, Female, BioGenomicsTM

Sign In for Pricing
View Details
Human Aromatic-L-Amino-Acid Decarboxylase (DDC) CLIA Kit
abx495210-01 96 Tests

Human Aromatic-L-Amino-Acid Decarboxylase (DDC) CLIA Kit

Sign In for Pricing
View Details
Human Aromatic-L-Amino-Acid Decarboxylase (DDC) CLIA Kit
abx495210-02 5x 96 Tests

Human Aromatic-L-Amino-Acid Decarboxylase (DDC) CLIA Kit

Sign In for Pricing
View Details
Human Aromatic-L-Amino-Acid Decarboxylase (DDC) CLIA Kit
abx495210-03 10x 96 Tests

Human Aromatic-L-Amino-Acid Decarboxylase (DDC) CLIA Kit

Sign In for Pricing
View Details