Human PTN protein (Active)
This Human PTN protein (Active) spans the amino acid sequence from region 33-168aa. Purity: > 96% as determined by SDS-PAGE and HPLC.
Product Specifications
Product Name Alternative
PTN, HBBM, Heparin-binding growth factor 8, HBGF-8, Heparin-binding growth-associated molecule
UniProt
P21246
Expression Region
33-168aa
Tag
Tag-Free
Source
E.Coli
Origin
Homo sapiens (Human)
Field of Research
Immunology & Inflammation
Endotoxin
Less than 1.0 EU/μg as determined by LAL method.
Purity
> 96% as determined by SDSPAGE and HPLC.
Bioactivity
Fully biologically active when compared to standard. The biological activity was measured by its ability to enhance neurite outgrowth of E16E18 rat embryonic cortical neurons, when neurons were plated on 96 well culture plates that had been precoated with 100 μl/well of a solution of 510 μg/ml rHuPTN.
Form
Lyophilized powder
Molecular Weight
15.3 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
Applications Notes
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Preservative
Lyophilized from a 0.2 μm filtered PBS, pH 7.4
AA Sequence
GKKEKPEKKVKKSDCGEWQWSVCVPTSGDCGLGTREGTRTGAECKQTMKTQRCKIPCNWKKQFGAECKYQFQAWGECDLNTALKTRTGSLKRALHNAECQKTVTISKPCGKLTKPKPQAESKKKKKEGKKQEKMLD
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
CM-M236-01 100 mL
Mouse Synovial Mesenchymal Stem Cell Complete Medium
Sign In for Pricing
View Details CM-M236-02 4x 125 mL
Mouse Synovial Mesenchymal Stem Cell Complete Medium
Sign In for Pricing
View Details F2556 96 Tests
NADH Dehydrogenase [ubiquinone] 1 β subcomplex subunit 3 (NDUFB3) Bovine ELISA Kit
Sign In for Pricing
View Details