Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human FGF4 protein (Active)

This Human FGF4 protein (Active) spans the amino acid sequence from region 25-206aa. Purity: > 96% as determined by SDS-PAGE and HPLC.

Product Specifications

Product Name Alternative

FGF-4, HST, HST-1, HSTF-1, Heparin-binding growth factor 4

UniProt

P08620

Expression Region

25-206aa

Tag

Tag-Free

Source

E.Coli

Origin

Homo sapiens (Human)

Field of Research

Stem Cell & Developmental Biology

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

> 96% as determined by SDS­PAGE and HPLC.

Bioactivity

Fully biologically active when compared to standard. The ED50 as determined by thymidine uptake assay using FGF­receptors transfected BaF3 cells is less than 0.5 ng/ml, corresponding to a specific activity of > 2.0 x 10 ^ 6 IU/mg.

Form

Lyophilized powder

Molecular Weight

19.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

Lyophilized from a 0.2 μm filtered PBS, pH 7.4, 300 mM NaCl

AA Sequence

GRGGAAAPTAPNGTLEAELERRWESLVALSLARLPVAAQPKEAAVQSGAGDYLLGIKRLRRLYCNVGIGFHLQALPDGRIGGAHADTRDSLLELSPVERGVVSIFGVASRFFVAMSSKGKLYGSPFFTDECTFKEILLPNNYNAYESYKYPGMFIALSKNGKTKKGNRVSPTMKVTHFLPRL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Danio rerio N-acetylglucosamine-1-phosphotransferase subunits alpha/beta (gnptab)
orb2926472-01 20 µg

Recombinant Danio rerio N-acetylglucosamine-1-phosphotransferase subunits alpha/beta (gnptab)

Sign In for Pricing
View Details
Recombinant Danio rerio N-acetylglucosamine-1-phosphotransferase subunits alpha/beta (gnptab)
orb2926472-02 100 µg

Recombinant Danio rerio N-acetylglucosamine-1-phosphotransferase subunits alpha/beta (gnptab)

Sign In for Pricing
View Details
Mouse Monoclonal CD45.1 Antibody (A20) [Alexa Fluor 647]
NBP1-28070AF647 0.25 mL

Mouse Monoclonal CD45.1 Antibody (A20) [Alexa Fluor 647]

Sign In for Pricing
View Details
TentaGel® N G
N30002-3.1G 1 g

TentaGel® N G

Sign In for Pricing
View Details
Cpe (NM_013128) Rat Untagged Clone
RN208147 10 µg

Cpe (NM_013128) Rat Untagged Clone

Sign In for Pricing
View Details
CDC27 Antibody, FITC conjugated
CSB-PA004999LC01HU-01 50 µg

CDC27 Antibody, FITC conjugated

Sign In for Pricing
View Details