What is the catalog number for Human FGF4 protein (Active)?

The catalog number for Human FGF4 protein (Active) is orb359152.

What sizes are available for Human FGF4 protein (Active)?

Human FGF4 protein (Active) is available in the following size(s): 5 µg, 100 µg, 500 µg.

How many pack sizes does Human FGF4 protein (Active) come in?

Human FGF4 protein (Active) is available in 3 different pack sizes.

Is Human FGF4 protein (Active) in stock?

Human FGF4 protein (Active) is currently made to order / not held in immediate stock. Contact us for lead time.

Human FGF4 protein (Active)

This Human FGF4 protein (Active) spans the amino acid sequence from region 25-206aa. Purity: > 96% as determined by SDS-PAGE and HPLC.

Product Specifications

Product Name Alternative

FGF-4, HST, HST-1, HSTF-1, Heparin-binding growth factor 4

UniProt

P08620

Expression Region

25-206aa

Tag

Tag-Free

Source

E.Coli

Origin

Homo sapiens (Human)

Field of Research

Stem Cell & Developmental Biology

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

> 96% as determined by SDSPAGE and HPLC.

Bioactivity

Fully biologically active when compared to standard. The ED50 as determined by thymidine uptake assay using FGFreceptors transfected BaF3 cells is less than 0.5 ng/ml, corresponding to a specific activity of > 2.0 x 10 ^ 6 IU/mg.

Form

Lyophilized powder

Molecular Weight

19.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

Lyophilized from a 0.2 μm filtered PBS, pH 7.4, 300 mM NaCl

AA Sequence

GRGGAAAPTAPNGTLEAELERRWESLVALSLARLPVAAQPKEAAVQSGAGDYLLGIKRLRRLYCNVGIGFHLQALPDGRIGGAHADTRDSLLELSPVERGVVSIFGVASRFFVAMSSKGKLYGSPFFTDECTFKEILLPNNYNAYESYKYPGMFIALSKNGKTKKGNRVSPTMKVTHFLPRL