Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human F19A2 protein (Active)

This Human F19A2 protein (Active) spans the amino acid sequence from region 31-131aa. Purity: > 95% as determined by SDS-PAGE and HPLC.

Product Specifications

Product Name Alternative

Chemokine-like protein TAFA-2

UniProt

Q8N3H0

Expression Region

31-131aa

Tag

Tag-Free

Source

E.Coli

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

> 95% as determined by SDS­PAGE and HPLC.

Bioactivity

Fully biologically active when compared to standard. The biological activity is determined by its ability to enhance neurite outgrowth of E16­E18 rat embryonic cortical neurons. rHuTAFA­2, immobilized at 6­24 μg/mL on a 96 well plate, is able to significantly enhance neurite outgrowth.

Form

Lyophilized powder

Molecular Weight

11.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

Lyophilized from a 0.2 μm filtered PBS, pH 7.4

AA Sequence

ANHHKAHHVKTGTCEVVALHRCCNKNKIEERSQTVKCSCFPGQVAGTTRAAPSCVDASIVEQKWWCHMQPCLEGEECKVLPDRKGWSCSSGNKVKTTRVTH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TSSK6, NT (TSSK6, SSTK, Testis-specific serine/threonine-protein kinase 6, Cancer/testis antigen 72, Serine/threonine-protein kinase SSTK, Small serine/threonine kinase) (MaxLight 650)
MBS6359790-01 0.1 mL

TSSK6, NT (TSSK6, SSTK, Testis-specific serine/threonine-protein kinase 6, Cancer/testis antigen 72, Serine/threonine-protein kinase SSTK, Small serine/threonine kinase) (MaxLight 650)

Sign In for Pricing
View Details
TSSK6, NT (TSSK6, SSTK, Testis-specific serine/threonine-protein kinase 6, Cancer/testis antigen 72, Serine/threonine-protein kinase SSTK, Small serine/threonine kinase) (MaxLight 650)
MBS6359790-02 5x 0.1 mL

TSSK6, NT (TSSK6, SSTK, Testis-specific serine/threonine-protein kinase 6, Cancer/testis antigen 72, Serine/threonine-protein kinase SSTK, Small serine/threonine kinase) (MaxLight 650)

Sign In for Pricing
View Details
Nuf2 Rabbit mAb
E2R383022 100 µL

Nuf2 Rabbit mAb

Sign In for Pricing
View Details
THAP1 Protein Vector (Mouse) (pPB-C-His)
PV238046 500 ng

THAP1 Protein Vector (Mouse) (pPB-C-His)

Sign In for Pricing
View Details
Lentiviral mouse 1700029I15Rik shRNA (UAS) - Lentiviral mouse 1700029I15Rik shRNA (UAS) (25)
GTR15264689 1 Vial

Lentiviral mouse 1700029I15Rik shRNA (UAS) - Lentiviral mouse 1700029I15Rik shRNA (UAS) (25)

Sign In for Pricing
View Details
Ns5atp4 3'UTR Luciferase Stable Cell Line
TU214208 1.0 mL

Ns5atp4 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details