Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human F19A2 protein (Active)

This Human F19A2 protein (Active) spans the amino acid sequence from region 31-131aa. Purity: > 95% as determined by SDS-PAGE and HPLC.

Product Specifications

Product Name Alternative

Chemokine-like protein TAFA-2

UniProt

Q8N3H0

Expression Region

31-131aa

Tag

Tag-Free

Source

E.Coli

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

> 95% as determined by SDS­PAGE and HPLC.

Bioactivity

Fully biologically active when compared to standard. The biological activity is determined by its ability to enhance neurite outgrowth of E16­E18 rat embryonic cortical neurons. rHuTAFA­2, immobilized at 6­24 μg/mL on a 96 well plate, is able to significantly enhance neurite outgrowth.

Form

Lyophilized powder

Molecular Weight

11.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

Lyophilized from a 0.2 μm filtered PBS, pH 7.4

AA Sequence

ANHHKAHHVKTGTCEVVALHRCCNKNKIEERSQTVKCSCFPGQVAGTTRAAPSCVDASIVEQKWWCHMQPCLEGEECKVLPDRKGWSCSSGNKVKTTRVTH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Florfenicol
TRC-F405750-2.5G 2.5 g

Florfenicol

Sign In for Pricing
View Details
3β-HSD2 siRNA (m)
sc-108885 10 µM

3β-HSD2 siRNA (m)

Sign In for Pricing
View Details
Mouse Substance P, SP ELISA Kit
MBS702782-01 24 Well (LIMIT 1)

Mouse Substance P, SP ELISA Kit

Sign In for Pricing
View Details
Mouse Substance P, SP ELISA Kit
MBS702782-02 48 Well

Mouse Substance P, SP ELISA Kit

Sign In for Pricing
View Details
Mouse Substance P, SP ELISA Kit
MBS702782-03 96 Well

Mouse Substance P, SP ELISA Kit

Sign In for Pricing
View Details
Mouse Substance P, SP ELISA Kit
MBS702782-04 5x 96 Well

Mouse Substance P, SP ELISA Kit

Sign In for Pricing
View Details