Human SDF1 protein (Active)
This Human SDF1 protein (Active) spans the amino acid sequence from region 21-119aa. Purity: > 96% as determined by SDS-PAGE and HPLC.
Product Specifications
Product Name Alternative
C-X-C motif chemokine 12 protein, CXCL12 protein, CXCL-12 protein, CXCL 12 protein, hIRH protein, hSDF-1 protein, Intercrine reduced in hepatomas protein, IRH protein, PBSF protein, SCYB12 protein, SDF 1 alpha protein, SDF 1 protein, SDF 1 beta protein, SDF 1b protein, SDF-1 protein, SDF-1a protein, SDF-1b protein, SDF1 protein, SDF1a protein, SDF1b protein, Stromal cell derived factor 1 protein, TLSF a protein, TLSF protein, TLSF b protein, TLSF-a protein, TLSF-b protein, TLSFa protein, TLSFb protein, TPAR1 protein
UniProt
P48061
Expression Region
21-119aa
Tag
Tag-Free
Source
E.Coli
Origin
Homo sapiens (Human)
Field of Research
Immunology & Inflammation
Endotoxin
Less than 1.0 EU/μg as determined by LAL method.
Purity
> 96% as determined by SDS-PAGE and HPLC.
Bioactivity
Fully biologically active when compared to standard. The biological activity determined by a chemotaxis bioassay using PHA and rHuIL2 activated human peripheral blood Tlymphocytes is in a concentration range of 30100 ng/ml.
Form
Lyophilized powder
Molecular Weight
11.6 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
Applications Notes
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Preservative
Lyophilized from a 0.2 μm filtered PBS, pH 7.4
AA Sequence
GKPVSLSYRCPCRFFESHVARANVKHLKILNTPNCALQIVARLKNNNRQVCIDPKLKWIQEYLEKALNKGRREEKVGKKEKIGKKKRQKKRKAAQKRKN
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog