Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human SDF1 protein (Active)

This Human SDF1 protein (Active) spans the amino acid sequence from region 21-119aa. Purity: > 96% as determined by SDS-PAGE and HPLC.

Product Specifications

Product Name Alternative

C-X-C motif chemokine 12 protein, CXCL12 protein, CXCL-12 protein, CXCL 12 protein, hIRH protein, hSDF-1 protein, Intercrine reduced in hepatomas protein, IRH protein, PBSF protein, SCYB12 protein, SDF 1 alpha protein, SDF 1 protein, SDF 1 beta protein, SDF 1b protein, SDF-1 protein, SDF-1a protein, SDF-1b protein, SDF1 protein, SDF1a protein, SDF1b protein, Stromal cell derived factor 1 protein, TLSF a protein, TLSF protein, TLSF b protein, TLSF-a protein, TLSF-b protein, TLSFa protein, TLSFb protein, TPAR1 protein

UniProt

P48061

Expression Region

21-119aa

Tag

Tag-Free

Source

E.Coli

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

> 96% as determined by SDS-­PAGE and HPLC.

Bioactivity

Fully biologically active when compared to standard. The biological activity determined by a chemotaxis bioassay using PHA and rHuIL­2 activated human peripheral blood T­lymphocytes is in a concentration range of 30­100 ng/ml.

Form

Lyophilized powder

Molecular Weight

11.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

Lyophilized from a 0.2 μm filtered PBS, pH 7.4

AA Sequence

GKPVSLSYRCPCRFFESHVARANVKHLKILNTPNCALQIVARLKNNNRQVCIDPKLKWIQEYLEKALNKGRREEKVGKKEKIGKKKRQKKRKAAQKRKN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Sheep Uncharacterized Protein C1orf54 (C1ORF54) ELISA Kit
OM620014 96 Strip Well

Sheep Uncharacterized Protein C1orf54 (C1ORF54) ELISA Kit

Sign In for Pricing
View Details
C-REL Rabbit Polyclonal Antibody (PerCP-Cy5.5)
orb1974781 100 µL

C-REL Rabbit Polyclonal Antibody (PerCP-Cy5.5)

Sign In for Pricing
View Details
KPTN, ID (KPTN, Kaptin, Actin-associated protein 2E4) (Biotin)
MBS6314438-01 0.2 mL

KPTN, ID (KPTN, Kaptin, Actin-associated protein 2E4) (Biotin)

Sign In for Pricing
View Details
KPTN, ID (KPTN, Kaptin, Actin-associated protein 2E4) (Biotin)
MBS6314438-02 5x 0.2 mL

KPTN, ID (KPTN, Kaptin, Actin-associated protein 2E4) (Biotin)

Sign In for Pricing
View Details
Rat Sex Determining Region Y Box Protein 2 (SOX2) ELISA Kit
MBS454133-01 48 Tests

Rat Sex Determining Region Y Box Protein 2 (SOX2) ELISA Kit

Sign In for Pricing
View Details
Rat Sex Determining Region Y Box Protein 2 (SOX2) ELISA Kit
MBS454133-02 96 Tests

Rat Sex Determining Region Y Box Protein 2 (SOX2) ELISA Kit

Sign In for Pricing
View Details