Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse CSF3 protein (Active)

This Mouse CSF3 protein (Active) spans the amino acid sequence from region 31-208aa. Purity: > 98% as determined by SDS-PAGE and HPLC.

Product Specifications

Product Name Alternative

G-CSF

UniProt

P09920

Expression Region

31-208aa

Tag

Tag-Free

Source

E.Coli

Origin

Mus musculus (Mouse)

Field of Research

Immunology & Inflammation

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

> 98% as determined by SDS­PAGE and HPLC.

Bioactivity

Fully biologically active when compared to standard. The ED50 as determined by a cell proliferation assay using murine NFS­60 cells is less than 0.05 ng/ml, corresponding to a specific activity of > 2.0 x 10 ^ 7 IU/mg.

Form

Lyophilized powder

Molecular Weight

18.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

Lyophilized from a 0.2 μm filtered 10 mM Sodium Citrate, pH 4.0, 150 mM NaCl, 0.01 % Tween­20

AA Sequence

VPLVTVSALPPSLPLPRSFLLKSLEQVRKIQASGSVLLEQLCATYKLCHPEELVLLGHSLGIPKASLSGCSSQALQQTQCLSQLHSGLCLYQGLLQALSGISPALAPTLDLLQLDVANFATTIWQQMENLGVAPTVQPTQSAMPAFTSAFQRRAGGVLAISYLQGFLETARLALHHLA

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ahcy sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)
K4895605 3x 1.0 µg

Ahcy sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)

Sign In for Pricing
View Details
P-Rosaniline (base) 95% Dye Content For Microscopy
02259 00025 25 g

P-Rosaniline (base) 95% Dye Content For Microscopy

Sign In for Pricing
View Details
Cynomolgus Monkey IGFBP4 HEK293 Cell Overexpression Lysate
NHFF-0524-HX664 Each

Cynomolgus Monkey IGFBP4 HEK293 Cell Overexpression Lysate

Sign In for Pricing
View Details
Bad, Phosphorylated (Ser75) (Bcl2 Antagonist of Cell Death) (MaxLight 550)
MBS6464774-01 0.1 mL

Bad, Phosphorylated (Ser75) (Bcl2 Antagonist of Cell Death) (MaxLight 550)

Sign In for Pricing
View Details
Bad, Phosphorylated (Ser75) (Bcl2 Antagonist of Cell Death) (MaxLight 550)
MBS6464774-02 5x 0.1 mL

Bad, Phosphorylated (Ser75) (Bcl2 Antagonist of Cell Death) (MaxLight 550)

Sign In for Pricing
View Details
Human Interleukin 17D (IL17D) ELISA Kit
abx574376 96 Well

Human Interleukin 17D (IL17D) ELISA Kit

Sign In for Pricing
View Details