Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human CTPS1 protein

This Human CTPS1 protein spans the amino acid sequence from region 1-591aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

CTP synthetase 1 UTP--ammonia ligase 1

UniProt

P17812

Expression Region

1-591aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Homo sapiens (Human)

Field of Research

Epigenetics & Chromatin

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

68.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MKYILVTGGVISGIGKGIIASSVGTILKSCGLHVTSIKIDPYINIDAGTFSPYEHGEVFVLDDGGEVDLDLGNYERFLDIRLTKDNNLTTGKIYQYVINKERKGDYLGKTVQVVPHITDAIQEWVMRQALIPVDEDGLEPQVCVIELGGTVGDIESMPFIEAFRQFQFKVKRENFCNIHVSLVPQPSSTGEQKTKPTQNSVRELRGLGLSPDLVVCRCSNPLDTSVKEKISMFCHVEPEQVICVHDVSSIYRVPLLLEEQGVVDYFLRRLDLPIERQPRKMLMKWKEMADRYDRLLETCSIALVGKYTKFSDSYASVIKALEHSALAINHKLEIKYIDSADLEPITSQEEPVRYHEAWQKLCSAHGVLVPGGFGVRGTEGKIQAIAWARNQKKPFLGVCLGMQLAVVEFSRNVLGWQDANSTEFDPTTSHPVVVDMPEHNPGQMGGTMRLGKRRTLFQTKNSVMRKLYGDADYLEERHRHRFEVNPVWKKCLEEQGLKFVGQDVEGERMEIVELEDHPFFVGVQYHPEFLSRPIKPSPPYFGLLLASVGRLSHYLQKGCRLSPRDTYSDRSGSSSPDSEITELKFPSINHD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Threo-Guaiacylglycerol
TN5145 1 mg

Threo-Guaiacylglycerol

Sign In for Pricing
View Details
Hamster microtubule-actin crosslinking factor 1 ELISA Kit
MBS7273297-01 48 Well

Hamster microtubule-actin crosslinking factor 1 ELISA Kit

Sign In for Pricing
View Details
Hamster microtubule-actin crosslinking factor 1 ELISA Kit
MBS7273297-02 96 Well

Hamster microtubule-actin crosslinking factor 1 ELISA Kit

Sign In for Pricing
View Details
Hamster microtubule-actin crosslinking factor 1 ELISA Kit
MBS7273297-03 5x 96 Well

Hamster microtubule-actin crosslinking factor 1 ELISA Kit

Sign In for Pricing
View Details
Hamster microtubule-actin crosslinking factor 1 ELISA Kit
MBS7273297-04 10x 96 Well

Hamster microtubule-actin crosslinking factor 1 ELISA Kit

Sign In for Pricing
View Details
2-Aminophenyl β-D-glucuronide
MA15320-01 50 mg

2-Aminophenyl β-D-glucuronide

Sign In for Pricing
View Details