Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human CTPS1 protein

This Human CTPS1 protein spans the amino acid sequence from region 1-591aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

CTP synthetase 1 UTP--ammonia ligase 1

UniProt

P17812

Expression Region

1-591aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Homo sapiens (Human)

Field of Research

Epigenetics & Chromatin

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

68.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MKYILVTGGVISGIGKGIIASSVGTILKSCGLHVTSIKIDPYINIDAGTFSPYEHGEVFVLDDGGEVDLDLGNYERFLDIRLTKDNNLTTGKIYQYVINKERKGDYLGKTVQVVPHITDAIQEWVMRQALIPVDEDGLEPQVCVIELGGTVGDIESMPFIEAFRQFQFKVKRENFCNIHVSLVPQPSSTGEQKTKPTQNSVRELRGLGLSPDLVVCRCSNPLDTSVKEKISMFCHVEPEQVICVHDVSSIYRVPLLLEEQGVVDYFLRRLDLPIERQPRKMLMKWKEMADRYDRLLETCSIALVGKYTKFSDSYASVIKALEHSALAINHKLEIKYIDSADLEPITSQEEPVRYHEAWQKLCSAHGVLVPGGFGVRGTEGKIQAIAWARNQKKPFLGVCLGMQLAVVEFSRNVLGWQDANSTEFDPTTSHPVVVDMPEHNPGQMGGTMRLGKRRTLFQTKNSVMRKLYGDADYLEERHRHRFEVNPVWKKCLEEQGLKFVGQDVEGERMEIVELEDHPFFVGVQYHPEFLSRPIKPSPPYFGLLLASVGRLSHYLQKGCRLSPRDTYSDRSGSSSPDSEITELKFPSINHD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GRB14 Antibody
orb1554981-01 50 μL

GRB14 Antibody

Sign In for Pricing
View Details
GRB14 Antibody
orb1554981-02 100 µL

GRB14 Antibody

Sign In for Pricing
View Details
GRB14 Antibody
orb1554981-03 200 µL

GRB14 Antibody

Sign In for Pricing
View Details
MARCKS, phosphorylated (Ser158) (Myristolated Alanine Rich C Kinase Substrate, Myristoylated Alanine Rich Protein Kinase C Substrate, MACS, MARCS, 80K-L Protein, 81kD Protein Light Chain, MGC52672, Phosphomyristin, PKCSL, PRKCSL, Protein Kinase C Substrat
MBS624559-01 0.05 mg

MARCKS, phosphorylated (Ser158) (Myristolated Alanine Rich C Kinase Substrate, Myristoylated Alanine Rich Protein Kinase C Substrate, MACS, MARCS, 80K-L Protein, 81kD Protein Light Chain, MGC52672, Phosphomyristin, PKCSL, PRKCSL, Protein Kinase C Substrat

Sign In for Pricing
View Details
MARCKS, phosphorylated (Ser158) (Myristolated Alanine Rich C Kinase Substrate, Myristoylated Alanine Rich Protein Kinase C Substrate, MACS, MARCS, 80K-L Protein, 81kD Protein Light Chain, MGC52672, Phosphomyristin, PKCSL, PRKCSL, Protein Kinase C Substrat
MBS624559-02 5x 0.05 mg

MARCKS, phosphorylated (Ser158) (Myristolated Alanine Rich C Kinase Substrate, Myristoylated Alanine Rich Protein Kinase C Substrate, MACS, MARCS, 80K-L Protein, 81kD Protein Light Chain, MGC52672, Phosphomyristin, PKCSL, PRKCSL, Protein Kinase C Substrat

Sign In for Pricing
View Details
RGD1562012 Protein Vector (Rat) (pPM-C-His)
PV300465 500 ng

RGD1562012 Protein Vector (Rat) (pPM-C-His)

Sign In for Pricing
View Details