Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human CTPS1 protein

This Human CTPS1 protein spans the amino acid sequence from region 1-591aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

CTP synthetase 1 UTP--ammonia ligase 1

UniProt

P17812

Expression Region

1-591aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Homo sapiens (Human)

Field of Research

Epigenetics & Chromatin

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

68.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MKYILVTGGVISGIGKGIIASSVGTILKSCGLHVTSIKIDPYINIDAGTFSPYEHGEVFVLDDGGEVDLDLGNYERFLDIRLTKDNNLTTGKIYQYVINKERKGDYLGKTVQVVPHITDAIQEWVMRQALIPVDEDGLEPQVCVIELGGTVGDIESMPFIEAFRQFQFKVKRENFCNIHVSLVPQPSSTGEQKTKPTQNSVRELRGLGLSPDLVVCRCSNPLDTSVKEKISMFCHVEPEQVICVHDVSSIYRVPLLLEEQGVVDYFLRRLDLPIERQPRKMLMKWKEMADRYDRLLETCSIALVGKYTKFSDSYASVIKALEHSALAINHKLEIKYIDSADLEPITSQEEPVRYHEAWQKLCSAHGVLVPGGFGVRGTEGKIQAIAWARNQKKPFLGVCLGMQLAVVEFSRNVLGWQDANSTEFDPTTSHPVVVDMPEHNPGQMGGTMRLGKRRTLFQTKNSVMRKLYGDADYLEERHRHRFEVNPVWKKCLEEQGLKFVGQDVEGERMEIVELEDHPFFVGVQYHPEFLSRPIKPSPPYFGLLLASVGRLSHYLQKGCRLSPRDTYSDRSGSSSPDSEITELKFPSINHD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Dehydroepiandrosterone (DHEA) (PE)
MBS6251769-01 0.1 mL

Dehydroepiandrosterone (DHEA) (PE)

Sign In for Pricing
View Details
Dehydroepiandrosterone (DHEA) (PE)
MBS6251769-02 5x 0.1 mL

Dehydroepiandrosterone (DHEA) (PE)

Sign In for Pricing
View Details
Lentiviral mouse Ackr3 shRNA (UAS) - Lentiviral mouse Ackr3 shRNA (UAS, RFP) (25)
GTR15254555 1 Vial

Lentiviral mouse Ackr3 shRNA (UAS) - Lentiviral mouse Ackr3 shRNA (UAS, RFP) (25)

Sign In for Pricing
View Details
9930021J03Rik 3'UTR GFP Stable Cell Line
TU151032 1.0 mL

9930021J03Rik 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
LEF1 Rabbit mAb
orb1564674-01 20 ul

LEF1 Rabbit mAb

Sign In for Pricing
View Details
LEF1 Rabbit mAb
orb1564674-02 50 µL

LEF1 Rabbit mAb

Sign In for Pricing
View Details