Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Nus1 protein

This Mouse Nus1 protein spans the amino acid sequence from region 24-120aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Di-trans, poly-cis-decaprenylcistransferaseCurated Nogo-B receptorBy similarity Short name, NgBRBy similarity Nuclear undecaprenyl pyrophosphate synthase 1 homolog

UniProt

Q99LJ8

Expression Region

24-120aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Mus musculus (Mouse)

Field of Research

Metabolism Research

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

13 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

SWLRVRFGTWNWIWRRCCRAASAAVLAPLGFTLRKPRAVGRNRRHHRHPHGGPGPGPGPAATHPRLRWRADVRSLQKLPVHMGLLVTEEVQEPSFSD

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Dopamine Receptor D5 DRD5 ELISA Kit
BG-HUM10740 1 Each

Human Dopamine Receptor D5 DRD5 ELISA Kit

Sign In for Pricing
View Details
Human Peroxisome Proliferator Activated Receptor Alpha (PPARa) ELISA Kit
MBS2021735-01 24 Strip Well

Human Peroxisome Proliferator Activated Receptor Alpha (PPARa) ELISA Kit

Sign In for Pricing
View Details
Human Peroxisome Proliferator Activated Receptor Alpha (PPARa) ELISA Kit
MBS2021735-02 48 Well

Human Peroxisome Proliferator Activated Receptor Alpha (PPARa) ELISA Kit

Sign In for Pricing
View Details
Human Peroxisome Proliferator Activated Receptor Alpha (PPARa) ELISA Kit
MBS2021735-03 96 Well

Human Peroxisome Proliferator Activated Receptor Alpha (PPARa) ELISA Kit

Sign In for Pricing
View Details
Human Peroxisome Proliferator Activated Receptor Alpha (PPARa) ELISA Kit
MBS2021735-04 5x 96 Well

Human Peroxisome Proliferator Activated Receptor Alpha (PPARa) ELISA Kit

Sign In for Pricing
View Details
Human Peroxisome Proliferator Activated Receptor Alpha (PPARa) ELISA Kit
MBS2021735-05 10x 96 Well

Human Peroxisome Proliferator Activated Receptor Alpha (PPARa) ELISA Kit

Sign In for Pricing
View Details