Rat Dac g 4 protein
This Rat Dac g 4 protein spans the amino acid sequence from region 1-55aa. Purity: Greater than 90% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
Allergen, Dac g 4
UniProt
P82946
Expression Region
1-55aa
Tag
N-terminal 6xHis-tagged
Source
Yeast
Origin
Dactylis glomerata (Orchard grass) (Cock's-foot grass)
Purity
Greater than 90% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Molecular Weight
8.4 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
Applications Notes
This is His-tag protein
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
AA Sequence
DIYNYMEPYVSKVDPTDYFGNEQARTAWVDSGAQLGELSYGVLFNIQYVNYWFAP
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
![RPL7A Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI4D5]](https://cdn.genprice.uk/products/937/6868c40a994c49e6dc4054eb/imageurl/ta811794bm.webp)
TA811794BM 100 µL
RPL7A Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI4D5]
Sign In for Pricing
View Details 
BNC401100-500 1x 500 µL
Cytokeratin, pan (KRTL/1077 + KRTH/1076), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC940715-100 1x 100 µL
Thymidylate Synthase (TMS715), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
AP26064PU-S 50 µL
Oct4 (POU5F1) (232-236) Rabbit Polyclonal Antibody
Sign In for Pricing
View Details