Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rat Dac g 4 protein

This Rat Dac g 4 protein spans the amino acid sequence from region 1-55aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Allergen, Dac g 4

UniProt

P82946

Expression Region

1-55aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Dactylis glomerata (Orchard grass) (Cock's-foot grass)

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

8.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

DIYNYMEPYVSKVDPTDYFGNEQARTAWVDSGAQLGELSYGVLFNIQYVNYWFAP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-TOB2 Antibody
CQA3299-01 30 µL

Anti-TOB2 Antibody

Sign In for Pricing
View Details
Anti-TOB2 Antibody
CQA3299-02 50 μL

Anti-TOB2 Antibody

Sign In for Pricing
View Details
Anti-TOB2 Antibody
CQA3299-03 100 µL

Anti-TOB2 Antibody

Sign In for Pricing
View Details
Anti-TOB2 Antibody
CQA3299-04 200 µL

Anti-TOB2 Antibody

Sign In for Pricing
View Details
STK16 (Serine/threonine-protein Kinase 16, Tyrosine-protein Kinase STK16, Myristoylated and Palmitoylated Serine/threonine-protein Kinase, MPSK, MPSK1, Protein Kinase PKL12, hPSK, TGF-beta-stimulated Factor 1, TSF1, TSF-1) (HRP)
133968-HRP 100 µL

STK16 (Serine/threonine-protein Kinase 16, Tyrosine-protein Kinase STK16, Myristoylated and Palmitoylated Serine/threonine-protein Kinase, MPSK, MPSK1, Protein Kinase PKL12, hPSK, TGF-beta-stimulated Factor 1, TSF1, TSF-1) (HRP)

Sign In for Pricing
View Details
USP36 Antibody, FITC Conjugated
MBS7134221-01 0.05 mL

USP36 Antibody, FITC Conjugated

Sign In for Pricing
View Details