Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rat Dac g 4 protein

This Rat Dac g 4 protein spans the amino acid sequence from region 1-55aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Allergen, Dac g 4

UniProt

P82946

Expression Region

1-55aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Dactylis glomerata (Orchard grass) (Cock's-foot grass)

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

8.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

DIYNYMEPYVSKVDPTDYFGNEQARTAWVDSGAQLGELSYGVLFNIQYVNYWFAP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Bcl-2 Monoclonal Antibody, Cy5.5 Conjugated
bsm-33411M-Cy5.5 100 µL

Bcl-2 Monoclonal Antibody, Cy5.5 Conjugated

Sign In for Pricing
View Details
Horse Homeobox A3 (HOXA3) ELISA Kit
MBS9381352-01 48 Well

Horse Homeobox A3 (HOXA3) ELISA Kit

Sign In for Pricing
View Details
Horse Homeobox A3 (HOXA3) ELISA Kit
MBS9381352-02 96 Well

Horse Homeobox A3 (HOXA3) ELISA Kit

Sign In for Pricing
View Details
Horse Homeobox A3 (HOXA3) ELISA Kit
MBS9381352-03 5x 96 Well

Horse Homeobox A3 (HOXA3) ELISA Kit

Sign In for Pricing
View Details
Horse Homeobox A3 (HOXA3) ELISA Kit
MBS9381352-04 10x 96 Well

Horse Homeobox A3 (HOXA3) ELISA Kit

Sign In for Pricing
View Details
(+) -5,7,4'-Trimethoxyafzelechin
T83604-01 5 mg

(+) -5,7,4'-Trimethoxyafzelechin

Sign In for Pricing
View Details