Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Bacterial Type III protein

This Bacterial Type III protein spans the amino acid sequence from region 19-424aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Gene 3 protein Short name, G3P Minor coat protein

UniProt

P69168

Expression Region

19-424aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Enterobacteria phage M13 (Bacteriophage M13)

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

44.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

AETVESCLAKPHTENSFTNVWKDDKTLDRYANYEGCLWNATGVVVCTGDETQCYGTWVPIGLAIPENEGGGSEGGGSEGGGSEGGGTKPPEYGDTPIPGYTYINPLDGTYPPGTEQNPANPNPSLEESQPLNTFMFQNNRFRNRQGALTVYTGTVTQGTDPVKTYYQYTPVSSKAMYDAYWNGKFRDCAFHSGFNEDPFVCEYQGQSSDLPQPPVNAGGGSGGGSGGGSEGGGSEGGGSEGGGSEGGGSGGGSGSGDFDYEKMANANKGAMTENADENALQSDAKGKLDSVATDYGAAIDGFIGDVSGLANGNGATGDFAGSNSQMAQVGDGDNSPLMNNFRQYLPSLPQSVECRPFVFSAGKPYEFSIDCDKINLFRGVFAFLLYVATFMYVFSTFANILRNKES

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZC3H6 shRNA Plasmid (m)
sc-155467-SH 20 µg

ZC3H6 shRNA Plasmid (m)

Sign In for Pricing
View Details
Fc Fragment of IgG Binding Protein (FcgammaBP) Porcine ELISA Kit
D3836 96 Tests

Fc Fragment of IgG Binding Protein (FcgammaBP) Porcine ELISA Kit

Sign In for Pricing
View Details
Ethyl 1-isocyanatocyclopropane-1-carboxylate
BDA12649-01 50 mg

Ethyl 1-isocyanatocyclopropane-1-carboxylate

Sign In for Pricing
View Details
Ethyl 1-isocyanatocyclopropane-1-carboxylate
BDA12649-02 0.5 g

Ethyl 1-isocyanatocyclopropane-1-carboxylate

Sign In for Pricing
View Details
Anti-Zebrafish wfikkn1 Antibody, Dylight594 Conjugate
DZ11633-Dylight594 200 µL

Anti-Zebrafish wfikkn1 Antibody, Dylight594 Conjugate

Sign In for Pricing
View Details
Mouse Zonula occludens-1 (ZO-1) ELISA Kit
orb2812088-01 48 Tests

Mouse Zonula occludens-1 (ZO-1) ELISA Kit

Sign In for Pricing
View Details