Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rat Rgn protein

This Rat Rgn protein spans the amino acid sequence from region 1-299aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Gluconolactonase (EC, 3.1.1.17) Short name, GNL Senescence marker protein 30 Short name, SMP-30

UniProt

Q03336

Expression Region

1-299aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Rattus norvegicus (Rat)

Field of Research

Epigenetics

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

35.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MSSIKIECVLRENYRCGESPVWEEASKCLLFVDIPSKTVCRWDSISNRVQRVGVDAPVSSVALRQSGGYVATIGTKFCALNWEDQSVFILAMVDEDKKNNRFNDGKVDPAGRYFAGTMAEETAPAVLERHQGSLYSLFPDHSVKKYFDQVDISNGLDWSLDHKIFYYIDSLSYTVDAFDYDLPTGQISNRRTVYKMEKDEQIPDGMCIDVEGKLWVACYNGGRVIRLDPETGKRLQTVKLPVDKTTSCCFGGKDYSEMYVTCARDGMSAEGLLRQPDAGNIFKITGLGVKGIAPYSYAG

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human Transcription factor ATOH7 (C-His)
BP2627-50ug 50 µg

Recombinant Human Transcription factor ATOH7 (C-His)

Sign In for Pricing
View Details
Rabbit Polyclonal PRICKLE2 Antibody [DyLight 405]
NBP2-81938V 0.1 mL

Rabbit Polyclonal PRICKLE2 Antibody [DyLight 405]

Sign In for Pricing
View Details
Pentafluorophenyl Trifluoroacetate
462191-01 1 g

Pentafluorophenyl Trifluoroacetate

Sign In for Pricing
View Details
Pentafluorophenyl Trifluoroacetate
462191-02 5 g

Pentafluorophenyl Trifluoroacetate

Sign In for Pricing
View Details
PSG4 Rabbit Polyclonal Antibody (HRP)
orb473697 100 µL

PSG4 Rabbit Polyclonal Antibody (HRP)

Sign In for Pricing
View Details
beta 1 Sodium Potassium ATPase (ATP1B1) (NM_001001787) Human Untagged Clone
SC300306 10 µg

beta 1 Sodium Potassium ATPase (ATP1B1) (NM_001001787) Human Untagged Clone

Sign In for Pricing
View Details