Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human PLA2G5 protein

This Human PLA2G5 protein spans the amino acid sequence from region 21-138aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Group V phospholipase A2 PLA2-10 Phosphatidylcholine 2-acylhydrolase 5

UniProt

P39877

Expression Region

21-138aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Homo sapiens (Human)

Field of Research

Metabolism Research

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

15.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

GLLDLKSMIEKVTGKNALTNYGFYGCYCGWGGRGTPKDGTDWCCWAHDHCYGRLEEKGCNIRTQSYKYRFAWGVVTCEPGPFCHVNLCACDRKLVYCLKRNLRSYNPQYQYFPNILCS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human IL-2 Superkine Recombinant Protein Fc Tag Lyophilized
MBS8432452-01 0.01 mg

Human IL-2 Superkine Recombinant Protein Fc Tag Lyophilized

Sign In for Pricing
View Details
Human IL-2 Superkine Recombinant Protein Fc Tag Lyophilized
MBS8432452-02 5x 0.01 mg

Human IL-2 Superkine Recombinant Protein Fc Tag Lyophilized

Sign In for Pricing
View Details
ACTC Polyclonal Antibody
MBS8531255-01 0.1 mg

ACTC Polyclonal Antibody

Sign In for Pricing
View Details
ACTC Polyclonal Antibody
MBS8531255-02 0.1 mL (AF635)

ACTC Polyclonal Antibody

Sign In for Pricing
View Details
ACTC Polyclonal Antibody
MBS8531255-03 0.1 mL (AF610)

ACTC Polyclonal Antibody

Sign In for Pricing
View Details
ACTC Polyclonal Antibody
MBS8531255-04 0.1 mL (AF405S)

ACTC Polyclonal Antibody

Sign In for Pricing
View Details