Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human PLA2G5 protein

This Human PLA2G5 protein spans the amino acid sequence from region 21-138aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Group V phospholipase A2 PLA2-10 Phosphatidylcholine 2-acylhydrolase 5

UniProt

P39877

Expression Region

21-138aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Homo sapiens (Human)

Field of Research

Metabolism Research

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

15.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

GLLDLKSMIEKVTGKNALTNYGFYGCYCGWGGRGTPKDGTDWCCWAHDHCYGRLEEKGCNIRTQSYKYRFAWGVVTCEPGPFCHVNLCACDRKLVYCLKRNLRSYNPQYQYFPNILCS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PDGF AA/PDGFA Rabbit Polyclonal Antibody (Carrier-free)
orb3111183 100 µg

PDGF AA/PDGFA Rabbit Polyclonal Antibody (Carrier-free)

Sign In for Pricing
View Details
LIN28B Rabbit Polyclonal Antibody (HRP)
orb2590093 100 µg

LIN28B Rabbit Polyclonal Antibody (HRP)

Sign In for Pricing
View Details
HEXA discontinued
389904 200 µL

HEXA discontinued

Sign In for Pricing
View Details
Rat Glial Cell Line Derived Neurotrophic Factor GDNF ELISA Kit
BG-RAT11072 1 Each

Rat Glial Cell Line Derived Neurotrophic Factor GDNF ELISA Kit

Sign In for Pricing
View Details
Fmoc-Pro TentaGel® S AC Resin
SA1122.1G 1 g

Fmoc-Pro TentaGel® S AC Resin

Sign In for Pricing
View Details
MACC1 (FITC)
567870-01 50 µg

MACC1 (FITC)

Sign In for Pricing
View Details