Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Pcsk5 protein

This Mouse Pcsk5 protein spans the amino acid sequence from region 117-452aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Proprotein convertase 5 Short name, PC5 Proprotein convertase 6 Short name, PC6 Subtilisin-like proprotein convertase 6 Short name, SPC6 Subtilisin/kexin-like protease PC5

UniProt

Q04592

Expression Region

117-452aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Mus musculus (Mouse)

Field of Research

Epigenetics

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

38.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

DYDLSHAQSTYFNDPKWPSMWYMHCSDNTHPCQSDMNIEGAWKRGYTGKNIVVTILDDGIERTHPDLMQNYDALASCDVNGNDLDPMPRYDASNENKHGTRCAGEVAATANNSHCTVGIAFNAKIGGVRMLDGDVTDMVEAKSVSYNPQHVHIYSASWGPDDDGKTVDGPAPLTRQAFENGVRMGRRGLGSVFVWASGNGGRSKDHCSCDGYTNSIYTISISSTAESGKKPWYLEECSSTLATTYSSGESYDKKIITTDLRQRCTDNHTGTSASAPMAAGIIALALEANPFLTWRDVQHVIVRTSRAGHLNANDWKTNAAGFKVSHLYGFGLMDAE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ompA Antibody
A50767-100UL 100 µL

ompA Antibody

Sign In for Pricing
View Details
DUSP15 Protein Vector (Human) (pPB-N-His)
PV013258 500 ng

DUSP15 Protein Vector (Human) (pPB-N-His)

Sign In for Pricing
View Details
CLK1 (R126) polyclonal antibody
orb643634-01 25 µL

CLK1 (R126) polyclonal antibody

Sign In for Pricing
View Details
CLK1 (R126) polyclonal antibody
orb643634-02 50 μL

CLK1 (R126) polyclonal antibody

Sign In for Pricing
View Details
CLK1 (R126) polyclonal antibody
orb643634-03 100 µL

CLK1 (R126) polyclonal antibody

Sign In for Pricing
View Details
CLK1 (R126) polyclonal antibody
orb643634-04 200 µL

CLK1 (R126) polyclonal antibody

Sign In for Pricing
View Details