What is the catalog number for Human GPR75 protein?

The catalog number for Human GPR75 protein is orb358239.

What sizes are available for Human GPR75 protein?

Human GPR75 protein is available in the following size(s): 20 µg, 100 µg, 1 mg.

How many pack sizes does Human GPR75 protein come in?

Human GPR75 protein is available in 3 different pack sizes.

Is Human GPR75 protein in stock?

Human GPR75 protein is currently made to order / not held in immediate stock. Contact us for lead time.

Human GPR75 protein

This Human GPR75 protein spans the amino acid sequence from region 372-540aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

G protein coupled receptor 75, GPR chr2, Gpr75, GPR75_HUMAN, GPRchr2, OTTHUMP00000159608, Probable G protein coupled receptor 75, Probable G-protein coupled receptor 75, WI 31133, WI31133

UniProt

O95800

Expression Region

372-540aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

20.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

NPFIYSRNSAGLRRKVLWCLQYIGLGFFCCKQKTRLRAMGKGNLEVNRNKSSHHETNSAYMLSPKPQKKFVDQACGPSHSKESMVSPKISAGHQHCGQSSSTPINTRIEPYYSIYNSSPSQEESSPCNLQPVNSFGFANSYIAMHYHTTNDLVQEYDSTSAKQIPVPSV