Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Monkey EPO protein

This Monkey EPO protein spans the amino acid sequence from region 28-192aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

EPOErythropoietin

UniProt

P07865

Expression Region

28-192aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)

Field of Research

Epigenetics

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

20.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

APPRLICDSRVLERYLLEAKEAENVTMGCSESCSLNENITVPDTKVNFYAWKRMEVGQQAVEVWQGLALLSEAVLRGQAVLANSSQPFEPLQLHMDKAISGLRSITTLLRALGAQEAISLPDAASAAPLRTITADTFCKLFRVYSNFLRGKLKLYTGEACRRGDR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mxd1 Rabbit Polyclonal Antibody
orb576544 100 µL

Mxd1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Decimeter Cube
1010220/A 1 Each

Decimeter Cube

Sign In for Pricing
View Details
Horse Complex Prostate Specific Antigen ELISA Kit
MBS026095-01 48 Well

Horse Complex Prostate Specific Antigen ELISA Kit

Sign In for Pricing
View Details
Horse Complex Prostate Specific Antigen ELISA Kit
MBS026095-02 96 Well

Horse Complex Prostate Specific Antigen ELISA Kit

Sign In for Pricing
View Details
Horse Complex Prostate Specific Antigen ELISA Kit
MBS026095-03 5x 96 Well

Horse Complex Prostate Specific Antigen ELISA Kit

Sign In for Pricing
View Details
Horse Complex Prostate Specific Antigen ELISA Kit
MBS026095-04 10x 96 Well

Horse Complex Prostate Specific Antigen ELISA Kit

Sign In for Pricing
View Details