Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human S100A7A protein

This Human S100A7A protein spans the amino acid sequence from region 2-101aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

S100A7A, S100A15, S100A7L1, Protein S100-A7A, S100 calcium-binding protein A15, S100 calcium-binding protein A7-like 1, S100 calcium-binding protein A7A

UniProt

Q86SG5

Expression Region

2-101aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

27.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-SUMO-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

SNTQAERSIIGMIDMFHKYTGRDGKIEKPSLLTMMKENFPNFLSACDKKGIHYLATVFEKKDKNEDKKIDFSEFLSLLGDIAADYHKQSHGAAPCSGGSQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse Itgb7 shRNA (UAS) - Lentiviral mouse Itgb7 shRNA (UAS, GFP) plasmid
GTR15306397 1 Vial

Lentiviral mouse Itgb7 shRNA (UAS) - Lentiviral mouse Itgb7 shRNA (UAS, GFP) plasmid

Sign In for Pricing
View Details
Mouse S100A9 DuoSet
DY2065 15 Plates

Mouse S100A9 DuoSet

Sign In for Pricing
View Details
MKNK1 Knockout HEK293T Polyclonal Cells
ARG4457 1 Million

MKNK1 Knockout HEK293T Polyclonal Cells

Sign In for Pricing
View Details
2-[ (4-Bromo-3-methyl-2-buten-1-yl) oxy]tetrahydro-2H-pyran
sc-503985 100 mg

2-[ (4-Bromo-3-methyl-2-buten-1-yl) oxy]tetrahydro-2H-pyran

Sign In for Pricing
View Details
ELP4 Rabbit Polyclonal Antibody (BF555)
orb2513268 100 µL

ELP4 Rabbit Polyclonal Antibody (BF555)

Sign In for Pricing
View Details
Canine malondialchehyche (MDA) ELISA Kit
MBS1602527-01 48 Well

Canine malondialchehyche (MDA) ELISA Kit

Sign In for Pricing
View Details