Human S100A7A protein
This Human S100A7A protein spans the amino acid sequence from region 2-101aa. Purity: Greater than 90% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
S100A7A, S100A15, S100A7L1, Protein S100-A7A, S100 calcium-binding protein A15, S100 calcium-binding protein A7-like 1, S100 calcium-binding protein A7A
UniProt
Q86SG5
Expression Region
2-101aa
Tag
N-terminal 6xHis-SUMO-tagged
Source
E.coli
Origin
Homo sapiens (Human)
Field of Research
Signal Transduction
Purity
Greater than 90% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Molecular Weight
27.2 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
Applications Notes
This is His-SUMO-tag protein
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
AA Sequence
SNTQAERSIIGMIDMFHKYTGRDGKIEKPSLLTMMKENFPNFLSACDKKGIHYLATVFEKKDKNEDKKIDFSEFLSLLGDIAADYHKQSHGAAPCSGGSQ
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
![Interferon regulatory factor 5 Rabbit Monoclonal Antibody [KD Validation]](https://cdn.genprice.uk/genprice/uk/genprice2.webp)
E51K2528 40 µL
Interferon regulatory factor 5 Rabbit Monoclonal Antibody [KD Validation]
Sign In for Pricing
View Details GTR15357928 1 Vial
Lentiviral human GPX7 sgRNA gene knockout kit - Lentiviral human GPX7 sgRNA gene knockout kit (100)
Sign In for Pricing
View Details 
A00237-4-HRP 100 µg/Vial
Anti-FADD Antibody Picoband®, HRP Conjugate
Sign In for Pricing
View Details 