Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human FGL2 protein

This Human FGL2 protein spans the amino acid sequence from region 24-439aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Fibrinogen-like protein 2 pT49

UniProt

Q14314

Expression Region

24-439aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

51.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

N-terminal 6xHis-tagged

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

NNETEEIKDERAKDVCPVRLESRGKCEEAGECPYQVSLPPLTIQLPKQFSRIEEVFKEVQNLKEIVNSLKKSCQDCKLQADDNGDPGRNGLLLPSTGAPGEVGDNRVRELESEVNKLSSELKNAKEEINVLHGRLEKLNLVNMNNIENYVDSKVANLTFVVNSLDGKCSKCPSQEQIQSRPVQHLIYKDCSDYYAIGKRSSETYRVTPDPKNSSFEVYCDMETMGGGWTVLQARLDGSTNFTRTWQDYKAGFGNLRREFWLGNDKIHLLTKSKEMILRIDLEDFNGVELYALYDQFYVANEFLKYRLHVGNYNGTAGDALRFNKHYNHDLKFFTTPDKDNDRYPSGNCGLYYSSGWWFDACLSANLNGKYYHQKYRGVRNGIFWGTWPGVSEAHPGGYKSSFKEAKMMIRPKHFKP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human PAX8 Ready-To-Use IHC Kit
IHC0514H 50 Tests

Human PAX8 Ready-To-Use IHC Kit

Sign In for Pricing
View Details
MRPL9 Antibody : Biotin (OAAF03137-Biotin)
OAAF03137-100UG-Biotin 100 µg

MRPL9 Antibody : Biotin (OAAF03137-Biotin)

Sign In for Pricing
View Details
Enzyme Mix (Trace dsRNA)
HBP000361-1 100 µL

Enzyme Mix (Trace dsRNA)

Sign In for Pricing
View Details
Recombinant Human adenovirus C serotype 2 Uncharacterized protein F-121
MBS1095659-01 0.02 mg (E-Coli)

Recombinant Human adenovirus C serotype 2 Uncharacterized protein F-121

Sign In for Pricing
View Details
Recombinant Human adenovirus C serotype 2 Uncharacterized protein F-121
MBS1095659-02 0.1 mg (E-Coli)

Recombinant Human adenovirus C serotype 2 Uncharacterized protein F-121

Sign In for Pricing
View Details
Recombinant Human adenovirus C serotype 2 Uncharacterized protein F-121
MBS1095659-03 0.02 mg (Yeast)

Recombinant Human adenovirus C serotype 2 Uncharacterized protein F-121

Sign In for Pricing
View Details